SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30101.Seq
         (454 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE013599-3231|AAF46736.1|  127|Drosophila melanogaster CG10433-P...    42   4e-04
AY094699-1|AAM11052.1|   98|Drosophila melanogaster GH10517p pro...    40   0.001
AE013599-3232|AAM70922.1|   98|Drosophila melanogaster CG10433-P...    40   0.001
BT010016-1|AAQ22485.1| 1349|Drosophila melanogaster RE15336p pro...    31   0.96 
AF215700-1|AAF25682.1| 1349|Drosophila melanogaster nitric oxide...    31   0.96 
AE014134-1966|AAZ66457.1|  704|Drosophila melanogaster CG6713-PH...    31   0.96 
AE014134-1965|AAZ66456.1|  746|Drosophila melanogaster CG6713-PI...    31   0.96 
AE014134-1964|AAZ66455.1|  756|Drosophila melanogaster CG6713-PJ...    31   0.96 
AE014134-1963|AAZ66454.1|  756|Drosophila melanogaster CG6713-PF...    31   0.96 
AE014134-1962|AAZ66453.1|  756|Drosophila melanogaster CG6713-PB...    31   0.96 
AE014134-1961|AAZ66452.1| 1349|Drosophila melanogaster CG6713-PC...    31   0.96 
AE014134-1960|AAF53014.1| 1349|Drosophila melanogaster CG6713-PA...    31   0.96 
AE014134-1959|AAZ66451.1|  815|Drosophila melanogaster CG6713-PG...    31   0.96 
AE014134-1958|AAZ66450.1| 1244|Drosophila melanogaster CG6713-PE...    31   0.96 
U25117-1|AAC46882.1| 1350|Drosophila melanogaster nitric oxide s...    29   3.9  
AE014296-2187|AAN11857.1|  872|Drosophila melanogaster CG17666-P...    29   3.9  
AY113210-1|AAM29215.1|  872|Drosophila melanogaster AT06220p pro...    28   6.8  
Z11527-1|CAA77616.1|  614|Drosophila melanogaster CYS3HIS finger...    27   8.9  
BT021256-1|AAX33404.1|  608|Drosophila melanogaster RE58038p pro...    27   8.9  
AE014297-3282|AAO41594.1|  599|Drosophila melanogaster CG4620-PB...    27   8.9  
AE014297-3281|AAO41593.1|  599|Drosophila melanogaster CG4620-PA...    27   8.9  

>AE013599-3231|AAF46736.1|  127|Drosophila melanogaster CG10433-PA,
           isoform A protein.
          Length = 127

 Score = 41.9 bits (94), Expect = 4e-04
 Identities = 17/42 (40%), Positives = 23/42 (54%)
 Frame = +3

Query: 120 CRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIECCYGVSVK 245
           C   GGLC    DC  +  +  GLCP    +G+ECCY + V+
Sbjct: 51  CVMVGGLCVAESDC-IEPTSNKGLCPTSAGEGVECCYELPVR 91



 Score = 30.3 bits (65), Expect = 1.3
 Identities = 13/34 (38%), Positives = 19/34 (55%)
 Frame = +2

Query: 260 KHGGECFSKGYCSQSLIYEEASDCPEGXDCCILV 361
           +H G+C  +  C Q L+    SDC  G  CC+L+
Sbjct: 97  EHLGQCMDR--CHQRLL-RPGSDCKNGQVCCVLI 127


>AY094699-1|AAM11052.1|   98|Drosophila melanogaster GH10517p
           protein.
          Length = 98

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +3

Query: 120 CRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIECCY 230
           C   GGLC    DC  +  +  GLCP    +G+ECCY
Sbjct: 51  CVMVGGLCVAESDC-IEPTSNKGLCPTSAGEGVECCY 86


>AE013599-3232|AAM70922.1|   98|Drosophila melanogaster CG10433-PB,
           isoform B protein.
          Length = 98

 Score = 40.3 bits (90), Expect = 0.001
 Identities = 16/37 (43%), Positives = 20/37 (54%)
 Frame = +3

Query: 120 CRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIECCY 230
           C   GGLC    DC  +  +  GLCP    +G+ECCY
Sbjct: 51  CVMVGGLCVAESDC-IEPTSNKGLCPTSAGEGVECCY 86


>BT010016-1|AAQ22485.1| 1349|Drosophila melanogaster RE15336p
           protein.
          Length = 1349

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  SS+  + RW  +
Sbjct: 238 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQV 297

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 298 RQSIETT 304


>AF215700-1|AAF25682.1| 1349|Drosophila melanogaster nitric oxide
           synthase protein.
          Length = 1349

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  SS+  + RW  +
Sbjct: 238 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQV 297

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 298 RQSIETT 304


>AE014134-1966|AAZ66457.1|  704|Drosophila melanogaster CG6713-PH,
           isoform H protein.
          Length = 704

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  SS+  + RW  +
Sbjct: 238 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQV 297

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 298 RQSIETT 304


>AE014134-1965|AAZ66456.1|  746|Drosophila melanogaster CG6713-PI,
           isoform I protein.
          Length = 746

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  SS+  + RW  +
Sbjct: 238 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQV 297

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 298 RQSIETT 304


>AE014134-1964|AAZ66455.1|  756|Drosophila melanogaster CG6713-PJ,
           isoform J protein.
          Length = 756

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  SS+  + RW  +
Sbjct: 238 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQV 297

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 298 RQSIETT 304


>AE014134-1963|AAZ66454.1|  756|Drosophila melanogaster CG6713-PF,
           isoform F protein.
          Length = 756

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  SS+  + RW  +
Sbjct: 238 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQV 297

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 298 RQSIETT 304


>AE014134-1962|AAZ66453.1|  756|Drosophila melanogaster CG6713-PB,
           isoform B protein.
          Length = 756

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  SS+  + RW  +
Sbjct: 238 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQV 297

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 298 RQSIETT 304


>AE014134-1961|AAZ66452.1| 1349|Drosophila melanogaster CG6713-PC,
           isoform C protein.
          Length = 1349

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  SS+  + RW  +
Sbjct: 238 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQV 297

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 298 RQSIETT 304


>AE014134-1960|AAF53014.1| 1349|Drosophila melanogaster CG6713-PA,
           isoform A protein.
          Length = 1349

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  SS+  + RW  +
Sbjct: 238 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQV 297

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 298 RQSIETT 304


>AE014134-1959|AAZ66451.1|  815|Drosophila melanogaster CG6713-PG,
           isoform G protein.
          Length = 815

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  SS+  + RW  +
Sbjct: 238 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQV 297

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 298 RQSIETT 304


>AE014134-1958|AAZ66450.1| 1244|Drosophila melanogaster CG6713-PE,
           isoform E protein.
          Length = 1244

 Score = 30.7 bits (66), Expect = 0.96
 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  SS+  + RW  +
Sbjct: 238 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSSTAHETRWKQV 297

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 298 RQSIETT 304


>U25117-1|AAC46882.1| 1350|Drosophila melanogaster nitric oxide
           synthase protein.
          Length = 1350

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 3/67 (4%)
 Frame = -3

Query: 323 KLLHISKIDCSSLSRNILRRASD---SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVL 153
           ++L  SK  C+S   NI   A +   S L   H+    +  F  ++  S +  + RW  +
Sbjct: 239 EILSCSKATCTSSIMNIGNAAVEARKSDLILEHAKDFLEQYFTSIKRTSCTAHETRWKQV 298

Query: 152 SHSTQTT 132
             S +TT
Sbjct: 299 RQSIETT 305


>AE014296-2187|AAN11857.1|  872|Drosophila melanogaster CG17666-PA,
           isoform A protein.
          Length = 872

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
 Frame = +3

Query: 51  CILVYGNSEDDFCEIDSIEQ--EDPCRREGGLCTVAEDCPSDIRARTG 188
           C     N +D    +D+  +  E+PC+     C   EDC  D  ARTG
Sbjct: 74  CSACGDNCKDPCLNMDACAESCENPCQDGKNGCKNPEDCAQDDLARTG 121


>AY113210-1|AAM29215.1|  872|Drosophila melanogaster AT06220p
           protein.
          Length = 872

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 2/48 (4%)
 Frame = +3

Query: 51  CILVYGNSEDDFCEIDSIEQ--EDPCRREGGLCTVAEDCPSDIRARTG 188
           C     N +D    +D+  +  E+PC+     C   EDC  D  ARTG
Sbjct: 74  CSACGDNCKDPCLNMDACAESCENPCQDGVNGCKNPEDCGQDDLARTG 121


>Z11527-1|CAA77616.1|  614|Drosophila melanogaster CYS3HIS finger
           protein protein.
          Length = 614

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +2

Query: 212 RNRMLLRSVRKRDQSRKHGGECFSKGYCSQSLIYEEASD-CPEGXDC 349
           +N+   R VRKRD +  +  +     YC++   Y+E +  CPEG +C
Sbjct: 69  QNQRRRRPVRKRDGTFNYSAD----NYCTK---YDETTGICPEGDEC 108


>BT021256-1|AAX33404.1|  608|Drosophila melanogaster RE58038p
           protein.
          Length = 608

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +2

Query: 212 RNRMLLRSVRKRDQSRKHGGECFSKGYCSQSLIYEEASD-CPEGXDC 349
           +N+   R VRKRD +  +  +     YC++   Y+E +  CPEG +C
Sbjct: 63  QNQRRRRPVRKRDGTFNYSAD----NYCTK---YDETTGICPEGDEC 102


>AE014297-3282|AAO41594.1|  599|Drosophila melanogaster CG4620-PB,
           isoform B protein.
          Length = 599

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +2

Query: 212 RNRMLLRSVRKRDQSRKHGGECFSKGYCSQSLIYEEASD-CPEGXDC 349
           +N+   R VRKRD +  +  +     YC++   Y+E +  CPEG +C
Sbjct: 54  QNQRRRRPVRKRDGTFNYSAD----NYCTK---YDETTGICPEGDEC 93


>AE014297-3281|AAO41593.1|  599|Drosophila melanogaster CG4620-PA,
           isoform A protein.
          Length = 599

 Score = 27.5 bits (58), Expect = 8.9
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
 Frame = +2

Query: 212 RNRMLLRSVRKRDQSRKHGGECFSKGYCSQSLIYEEASD-CPEGXDC 349
           +N+   R VRKRD +  +  +     YC++   Y+E +  CPEG +C
Sbjct: 54  QNQRRRRPVRKRDGTFNYSAD----NYCTK---YDETTGICPEGDEC 93


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,446,237
Number of Sequences: 53049
Number of extensions: 369192
Number of successful extensions: 1202
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 1154
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1199
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1476622287
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -