SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30099.Seq
         (730 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p pro...   233   2e-61
AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD...   233   2e-61
AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC...   233   2e-61
AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB...   233   2e-61
AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA...   233   2e-61
X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha pro...   230   1e-60
BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p pro...   230   2e-60
AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB...   230   2e-60
AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA...   230   2e-60
X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha pro...   219   3e-57
M11744-1|AAA28526.1|  463|Drosophila melanogaster protein ( D.me...   219   3e-57
BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p pro...   181   8e-46
AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p pro...   181   8e-46
U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation fac...   123   3e-28
AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p pro...   122   5e-28
AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA...   122   5e-28
BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p pro...   107   2e-23
AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA ...   107   2e-23
BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p pro...    71   2e-12
AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p pro...    71   2e-12
AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA...    71   2e-12
BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p pro...    69   7e-12
AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p pro...    69   7e-12
AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA...    69   7e-12
AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p pro...    46   7e-05
AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-P...    45   1e-04
AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p pro...    42   7e-04
AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA...    42   7e-04
X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein ...    40   0.003
BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p pro...    40   0.003
AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p pro...    40   0.003
AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic t...    40   0.003
AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC...    40   0.003
AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB...    40   0.003
X15805-1|CAA33804.1|  844|Drosophila melanogaster protein ( Dros...    34   0.23 
AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p pro...    34   0.23 
AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC...    34   0.23 
AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB...    34   0.23 
AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA...    34   0.23 
AY058769-1|AAL13998.1|  949|Drosophila melanogaster SD04694p pro...    32   0.92 
AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-P...    32   0.92 
AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-P...    31   2.1  
BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p pro...    30   2.8  
AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA...    30   2.8  
BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p pro...    30   3.7  
AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.    30   3.7  
AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA...    30   3.7  
BT023767-1|AAZ41775.1| 1144|Drosophila melanogaster RE11051p pro...    29   4.9  
AF143207-1|AAF36532.1| 1144|Drosophila melanogaster IF2 protein ...    29   4.9  
AE014296-661|AAF47774.2| 1144|Drosophila melanogaster CG10840-PB...    29   4.9  
AE013599-3570|AAM68240.2|  539|Drosophila melanogaster CG30416-P...    29   6.5  
M57496-1|AAA28983.1|  993|Drosophila melanogaster teashirt protein.    29   8.6  
BT015201-1|AAT94430.1|  683|Drosophila melanogaster RE67261p pro...    29   8.6  
AE014134-3546|AAS64735.1|  885|Drosophila melanogaster CG1374-PB...    29   8.6  
AE014134-3545|AAF57236.2|  954|Drosophila melanogaster CG1374-PA...    29   8.6  

>BT015202-1|AAT94431.1|  462|Drosophila melanogaster RE68984p
           protein.
          Length = 462

 Score =  233 bits (570), Expect = 2e-61
 Identities = 113/141 (80%), Positives = 119/141 (84%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDSTEPPY      + +++     KKIGYNPA+VAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE   K    +   VERK
Sbjct: 199 DNMLEPSEKMPWFKGWSVERK 219



 Score =  145 bits (352), Expect = 5e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 31.9 bits (69), Expect = 0.92
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 2/22 (9%)
 Frame = +3

Query: 669 WSV--R*GQADGKCLIEALDAI 728
           WSV  + G+A+GKCLI+ALDAI
Sbjct: 214 WSVERKEGKAEGKCLIDALDAI 235


>AE014297-4793|AAS65236.1|  462|Drosophila melanogaster CG1873-PD,
           isoform D protein.
          Length = 462

 Score =  233 bits (570), Expect = 2e-61
 Identities = 113/141 (80%), Positives = 119/141 (84%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDSTEPPY      + +++     KKIGYNPA+VAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE   K    +   VERK
Sbjct: 199 DNMLEPSEKMPWFKGWSVERK 219



 Score =  145 bits (352), Expect = 5e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 31.9 bits (69), Expect = 0.92
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 2/22 (9%)
 Frame = +3

Query: 669 WSV--R*GQADGKCLIEALDAI 728
           WSV  + G+A+GKCLI+ALDAI
Sbjct: 214 WSVERKEGKAEGKCLIDALDAI 235


>AE014297-4792|AAS65235.1|  462|Drosophila melanogaster CG1873-PC,
           isoform C protein.
          Length = 462

 Score =  233 bits (570), Expect = 2e-61
 Identities = 113/141 (80%), Positives = 119/141 (84%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDSTEPPY      + +++     KKIGYNPA+VAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE   K    +   VERK
Sbjct: 199 DNMLEPSEKMPWFKGWSVERK 219



 Score =  145 bits (352), Expect = 5e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 31.9 bits (69), Expect = 0.92
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 2/22 (9%)
 Frame = +3

Query: 669 WSV--R*GQADGKCLIEALDAI 728
           WSV  + G+A+GKCLI+ALDAI
Sbjct: 214 WSVERKEGKAEGKCLIDALDAI 235


>AE014297-4791|AAN14285.1|  462|Drosophila melanogaster CG1873-PB,
           isoform B protein.
          Length = 462

 Score =  233 bits (570), Expect = 2e-61
 Identities = 113/141 (80%), Positives = 119/141 (84%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDSTEPPY      + +++     KKIGYNPA+VAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE   K    +   VERK
Sbjct: 199 DNMLEPSEKMPWFKGWSVERK 219



 Score =  145 bits (352), Expect = 5e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 31.9 bits (69), Expect = 0.92
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 2/22 (9%)
 Frame = +3

Query: 669 WSV--R*GQADGKCLIEALDAI 728
           WSV  + G+A+GKCLI+ALDAI
Sbjct: 214 WSVERKEGKAEGKCLIDALDAI 235


>AE014297-4790|AAF57185.1|  462|Drosophila melanogaster CG1873-PA,
           isoform A protein.
          Length = 462

 Score =  233 bits (570), Expect = 2e-61
 Identities = 113/141 (80%), Positives = 119/141 (84%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDSTEPPY      + +++     KKIGYNPA+VAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE   K    +   VERK
Sbjct: 199 DNMLEPSEKMPWFKGWSVERK 219



 Score =  145 bits (352), Expect = 5e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 31.9 bits (69), Expect = 0.92
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 2/22 (9%)
 Frame = +3

Query: 669 WSV--R*GQADGKCLIEALDAI 728
           WSV  + G+A+GKCLI+ALDAI
Sbjct: 214 WSVERKEGKAEGKCLIDALDAI 235


>X06870-1|CAA29994.1|  462|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 462

 Score =  230 bits (563), Expect = 1e-60
 Identities = 112/141 (79%), Positives = 118/141 (83%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLI AAGTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIDAAGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDSTEPPY      + +++     KKIGYNPA+VAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSTEPPYSEARYEEIKKEVSSYIKKIGYNPASVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE   K    +   VERK
Sbjct: 199 DNMLEPSEKMPWFKGWSVERK 219



 Score =  145 bits (352), Expect = 5e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68



 Score = 31.9 bits (69), Expect = 0.92
 Identities = 15/22 (68%), Positives = 19/22 (86%), Gaps = 2/22 (9%)
 Frame = +3

Query: 669 WSV--R*GQADGKCLIEALDAI 728
           WSV  + G+A+GKCLI+ALDAI
Sbjct: 214 WSVERKEGKAEGKCLIDALDAI 235


>BT011039-1|AAR30199.1|  463|Drosophila melanogaster LP10071p
           protein.
          Length = 463

 Score =  230 bits (562), Expect = 2e-60
 Identities = 111/141 (78%), Positives = 119/141 (84%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDS+EPPY      + +++     KKIGYNPAAVAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +VERK
Sbjct: 199 DNMLEPSTNMPWFKGWKVERK 219



 Score =  145 bits (352), Expect = 5e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AE013599-1358|AAM68698.1|  463|Drosophila melanogaster CG8280-PB,
           isoform B protein.
          Length = 463

 Score =  230 bits (562), Expect = 2e-60
 Identities = 111/141 (78%), Positives = 119/141 (84%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDS+EPPY      + +++     KKIGYNPAAVAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +VERK
Sbjct: 199 DNMLEPSTNMPWFKGWKVERK 219



 Score =  145 bits (352), Expect = 5e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>AE013599-1357|AAF58608.1|  463|Drosophila melanogaster CG8280-PA,
           isoform A protein.
          Length = 463

 Score =  230 bits (562), Expect = 2e-60
 Identities = 111/141 (78%), Positives = 119/141 (84%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL
Sbjct: 79  KFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDS+EPPY      + +++     KKIGYNPAAVAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +VERK
Sbjct: 199 DNMLEPSTNMPWFKGWKVERK 219



 Score =  145 bits (352), Expect = 5e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>X06869-1|CAA29993.1|  463|Drosophila melanogaster EF-1-alpha
           protein.
          Length = 463

 Score =  219 bits (535), Expect = 3e-57
 Identities = 106/141 (75%), Positives = 115/141 (81%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAV I AAGTGEFEAGISKN QTREHAL
Sbjct: 79  KFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVQIDAAGTGEFEAGISKNDQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDS+EPPY      + +++     KK+GYNPAAVAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKVGYNPAAVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSTNMPWFKGWEVGRK 219



 Score =  145 bits (352), Expect = 5e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>M11744-1|AAA28526.1|  463|Drosophila melanogaster protein (
           D.melanogaster 50 kDaprotein F1 gene, complete cds. ).
          Length = 463

 Score =  219 bits (535), Expect = 3e-57
 Identities = 106/141 (75%), Positives = 115/141 (81%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           KFET+KYYVTIIDAPGHRDFIKNMITGTSQADCAV I AAGTGEFEAGISKN QTREHAL
Sbjct: 79  KFETAKYYVTIIDAPGHRDFIKNMITGTSQADCAVQIDAAGTGEFEAGISKNDQTREHAL 138

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           LAFTLGVKQLIVGVNKMDS+EPPY      + +++     KK+GYNPAAVAFVPISGWHG
Sbjct: 139 LAFTLGVKQLIVGVNKMDSSEPPYSEARYEEIKKEVSSYIKKVGYNPAAVAFVPISGWHG 198

Query: 617 DNMLELQPKCLGSRDGQVERK 679
           DNMLE        +  +V RK
Sbjct: 199 DNMLEPSTNMPWFKGWEVGRK 219



 Score =  145 bits (352), Expect = 5e-35
 Identities = 67/68 (98%), Positives = 67/68 (98%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 204
           MGKEK HINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL
Sbjct: 1   MGKEKIHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVL 60

Query: 205 DKLKAERE 228
           DKLKAERE
Sbjct: 61  DKLKAERE 68


>BT001873-1|AAN71645.1|  362|Drosophila melanogaster SD08285p
           protein.
          Length = 362

 Score =  181 bits (441), Expect = 8e-46
 Identities = 89/118 (75%), Positives = 96/118 (81%)
 Frame = +2

Query: 326 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 505
           MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDS+EPP
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPP 60

Query: 506 YVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDGQVERK 679
           Y      + +++     KKIGYNPAAVAFVPISGWHGDNMLE        +  +VERK
Sbjct: 61  YSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERK 118


>AY089522-1|AAL90260.1|  362|Drosophila melanogaster GM14559p
           protein.
          Length = 362

 Score =  181 bits (441), Expect = 8e-46
 Identities = 89/118 (75%), Positives = 96/118 (81%)
 Frame = +2

Query: 326 MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSTEPP 505
           MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDS+EPP
Sbjct: 1   MITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDSSEPP 60

Query: 506 YVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQPKCLGSRDGQVERK 679
           Y      + +++     KKIGYNPAAVAFVPISGWHGDNMLE        +  +VERK
Sbjct: 61  YSEARYEEIKKEVSSYIKKIGYNPAAVAFVPISGWHGDNMLEPSTNMPWFKGWKVERK 118


>U88868-1|AAC24943.1|  619|Drosophila melanogaster elongation factor
           1 alpha-likefactor protein.
          Length = 619

 Score =  123 bits (296), Expect = 3e-28
 Identities = 61/131 (46%), Positives = 83/131 (63%), Gaps = 1/131 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET + + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE G  + GQTREHA+L
Sbjct: 268 FETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQTREHAML 327

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK L+V VNKMD     +      + + K     KK+G+NPA  + F+P SG  G
Sbjct: 328 AKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFNPAKDLTFMPCSGLSG 387

Query: 617 DNMLELQPKCL 649
             + +  P+ L
Sbjct: 388 TGLKDQIPETL 398



 Score = 68.5 bits (160), Expect = 9e-12
 Identities = 29/65 (44%), Positives = 46/65 (70%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           ++ H+N+V IGHVD+GKST  G ++   G + KRT+EK+E+EA+E  + S+  +W LD  
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVHKRTLEKYEREAREKSRESWYLSWGLDTN 251

Query: 214 KAERE 228
           + ER+
Sbjct: 252 QEERD 256


>AY070979-1|AAL48601.1|  619|Drosophila melanogaster RE07731p
           protein.
          Length = 619

 Score =  122 bits (294), Expect = 5e-28
 Identities = 61/131 (46%), Positives = 83/131 (63%), Gaps = 1/131 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET + + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE G  + GQTREHA+L
Sbjct: 268 FETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQTREHAML 327

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK L+V VNKMD     +      + + K     KK+G+NPA  + F+P SG  G
Sbjct: 328 AKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFNPAKDLTFMPCSGLSG 387

Query: 617 DNMLELQPKCL 649
             + +  P+ L
Sbjct: 388 YGLKDQIPETL 398



 Score = 72.5 bits (170), Expect = 5e-13
 Identities = 30/65 (46%), Positives = 47/65 (72%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           ++ H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  + S+  +W LD  
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTN 251

Query: 214 KAERE 228
           + ER+
Sbjct: 252 QEERD 256


>AE014134-2205|AAF53194.1|  619|Drosophila melanogaster CG6382-PA
           protein.
          Length = 619

 Score =  122 bits (294), Expect = 5e-28
 Identities = 61/131 (46%), Positives = 83/131 (63%), Gaps = 1/131 (0%)
 Frame = +2

Query: 260 FETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           FET + + TI+DAPGH+ F+ NMI G +QAD AVL+++A  GEFE G  + GQTREHA+L
Sbjct: 268 FETDRKHFTILDAPGHKSFVPNMIGGAAQADLAVLVISARKGEFETGFDRGGQTREHAML 327

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAA-VAFVPISGWHG 616
           A T GVK L+V VNKMD     +      + + K     KK+G+NPA  + F+P SG  G
Sbjct: 328 AKTAGVKHLVVLVNKMDDPTVNWDQTRYNECKDKILPYLKKLGFNPAKDLTFMPCSGLSG 387

Query: 617 DNMLELQPKCL 649
             + +  P+ L
Sbjct: 388 YGLKDQIPETL 398



 Score = 72.5 bits (170), Expect = 5e-13
 Identities = 30/65 (46%), Positives = 47/65 (72%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           ++ H+N+V IGHVD+GKST  G ++   G +DKRT+EK+E+EA+E  + S+  +W LD  
Sbjct: 192 KREHVNVVFIGHVDAGKSTIGGQIMSLTGMVDKRTLEKYEREAREKSRESWYLSWALDTN 251

Query: 214 KAERE 228
           + ER+
Sbjct: 252 QEERD 256


>BT003766-1|AAO41445.1|  670|Drosophila melanogaster RE29053p
           protein.
          Length = 670

 Score =  107 bits (257), Expect = 2e-23
 Identities = 55/123 (44%), Positives = 76/123 (61%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEFE+G    GQTREHA+
Sbjct: 319 RIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFELGGQTREHAI 378

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V +NK+D+    +      +   K     K  G+  + V+F P SG  G
Sbjct: 379 LVRSLGVNQLGVVINKLDTV--GWSQDRFTEIVTKLKSFLKLAGFKDSDVSFTPCSGLTG 436

Query: 617 DNM 625
           +N+
Sbjct: 437 ENL 439



 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 34/64 (53%), Positives = 50/64 (78%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+ 
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 214 KAER 225
             ER
Sbjct: 304 GEER 307


>AE014296-376|AAF47584.2|  670|Drosophila melanogaster CG1898-PA
           protein.
          Length = 670

 Score =  107 bits (257), Expect = 2e-23
 Identities = 55/123 (44%), Positives = 76/123 (61%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           + ET    VT++DAPGH+DFI NMI+G +QAD A+L+V A  GEFE+G    GQTREHA+
Sbjct: 319 RIETKTKIVTLLDAPGHKDFIPNMISGATQADVALLVVDATRGEFESGFELGGQTREHAI 378

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHG 616
           L  +LGV QL V +NK+D+    +      +   K     K  G+  + V+F P SG  G
Sbjct: 379 LVRSLGVNQLGVVINKLDTV--GWSQDRFTEIVTKLKSFLKLAGFKDSDVSFTPCSGLTG 436

Query: 617 DNM 625
           +N+
Sbjct: 437 ENL 439



 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 34/64 (53%), Positives = 50/64 (78%)
 Frame = +1

Query: 34  EKTHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKL 213
           +K+HI+++VIGHVD+GKST  GHL+Y  G + +R + K E+E++++GK SF YAWVLD+ 
Sbjct: 244 QKSHIHMIVIGHVDAGKSTLMGHLLYDTGNVSQRVMHKHEQESKKLGKQSFMYAWVLDET 303

Query: 214 KAER 225
             ER
Sbjct: 304 GEER 307


>BT003749-1|AAO41413.1|  489|Drosophila melanogaster RH68252p
           protein.
          Length = 489

 Score = 70.9 bits (166), Expect = 2e-12
 Identities = 36/85 (42%), Positives = 52/85 (61%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G          QTREH L
Sbjct: 139 EYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP-------QTREHML 191

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYV 511
           LA  +G+  ++V +NK+D+ +   V
Sbjct: 192 LAKQIGIDHIVVFINKVDAADEEMV 216



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTT 96
           + K H N+  IGHVD GK+T T
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLT 99


>AY058493-1|AAL13722.1|  300|Drosophila melanogaster GM14682p
           protein.
          Length = 300

 Score = 70.9 bits (166), Expect = 2e-12
 Identities = 36/85 (42%), Positives = 52/85 (61%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G          QTREH L
Sbjct: 139 EYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP-------QTREHML 191

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYV 511
           LA  +G+  ++V +NK+D+ +   V
Sbjct: 192 LAKQIGIDHIVVFINKVDAADEEMV 216



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTT 96
           + K H N+  IGHVD GK+T T
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLT 99


>AE013599-1732|AAF58366.1|  489|Drosophila melanogaster CG6050-PA
           protein.
          Length = 489

 Score = 70.9 bits (166), Expect = 2e-12
 Identities = 36/85 (42%), Positives = 52/85 (61%)
 Frame = +2

Query: 257 KFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHAL 436
           +++T   +    D PGH D+IKNMITGT+Q D A+L+VAA  G          QTREH L
Sbjct: 139 EYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMP-------QTREHML 191

Query: 437 LAFTLGVKQLIVGVNKMDSTEPPYV 511
           LA  +G+  ++V +NK+D+ +   V
Sbjct: 192 LAKQIGIDHIVVFINKVDAADEEMV 216



 Score = 30.7 bits (66), Expect = 2.1
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTT 96
           + K H N+  IGHVD GK+T T
Sbjct: 78  RTKPHCNVGTIGHVDHGKTTLT 99


>BT010319-1|AAQ23637.1|  456|Drosophila melanogaster AT01345p
           protein.
          Length = 456

 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 36/81 (44%), Positives = 50/81 (61%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C   + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+         QTRE
Sbjct: 111 CHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP-------QTRE 163

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H LLA  +G++++IV +NK D
Sbjct: 164 HLLLAKQVGIQRIIVFINKAD 184



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTT 96
           +E  H N+  IGHVD GK+T T
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLT 74


>AY058330-1|AAL13559.1|  456|Drosophila melanogaster GH10272p
           protein.
          Length = 456

 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 36/81 (44%), Positives = 50/81 (61%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C   + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+         QTRE
Sbjct: 111 CHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP-------QTRE 163

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H LLA  +G++++IV +NK D
Sbjct: 164 HLLLAKQVGIQRIIVFINKAD 184



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTT 96
           +E  H N+  IGHVD GK+T T
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLT 74


>AE013599-436|AAF59240.1|  456|Drosophila melanogaster CG12736-PA
           protein.
          Length = 456

 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 36/81 (44%), Positives = 50/81 (61%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           C   + T++      D PGH D+IKNMI+G SQ D A+L+VAA  G+         QTRE
Sbjct: 111 CHIGYSTTERTYAHTDCPGHADYIKNMISGASQMDGAILVVAATDGQMP-------QTRE 163

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H LLA  +G++++IV +NK D
Sbjct: 164 HLLLAKQVGIQRIIVFINKAD 184



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 12/22 (54%), Positives = 15/22 (68%)
 Frame = +1

Query: 31  KEKTHINIVVIGHVDSGKSTTT 96
           +E  H N+  IGHVD GK+T T
Sbjct: 53  RELPHCNVGTIGHVDHGKTTLT 74


>AY119138-1|AAM50998.1|  696|Drosophila melanogaster RE37995p
           protein.
          Length = 696

 Score = 45.6 bits (103), Expect = 7e-05
 Identities = 43/137 (31%), Positives = 63/137 (45%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           VT +D PGH  F      G    D  VL+VAA     E G+    QTRE   LA    V 
Sbjct: 212 VTFLDTPGHAAFSAMRARGAVATDIIVLVVAA-----EDGVM--AQTREVIQLAKEAQV- 263

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQP 640
            +IV +NK+D  E      +++KS+R+       +  +   V  +PIS   G N LEL  
Sbjct: 264 PIIVALNKIDKPE-----ANIKKSKRELAQMGLALEEHGGDVQVIPISALKGTN-LELLA 317

Query: 641 KCLGSRDGQVERKVRPS 691
           + + ++   +  K  P+
Sbjct: 318 EAVSTQATLMGLKADPT 334


>AE014297-4239|AAF56796.2|  696|Drosophila melanogaster CG12413-PA
           protein.
          Length = 696

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 43/137 (31%), Positives = 62/137 (45%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVK 460
           VT +D PGH  F      G    D  VL+VAA     E G+    QTRE   LA    V 
Sbjct: 212 VTFLDTPGHAAFSAMRARGAVATDIIVLVVAA-----EDGVM--AQTREVIQLAKEAQV- 263

Query: 461 QLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQP 640
            +IV +NK+D  E      ++ KS+R+       +  +   V  +PIS   G N LEL  
Sbjct: 264 PIIVALNKIDKPE-----ANIEKSKRELAQMGLALEEHGGDVQVIPISALKGTN-LELLA 317

Query: 641 KCLGSRDGQVERKVRPS 691
           + + ++   +  K  P+
Sbjct: 318 EAVSTQATLMGLKADPT 334


>AY071627-1|AAL49249.1|  511|Drosophila melanogaster RE67487p
           protein.
          Length = 511

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 35/118 (29%), Positives = 52/118 (44%)
 Frame = +2

Query: 284 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 463
           T +D PGH   I+ +I G    D  +L+V A  G       K  QT E  L+   L  K+
Sbjct: 70  TFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-------KQTQTAE-CLIIGELLQKK 121

Query: 464 LIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQ 637
           LIV +NK+D       +  L K R +   T +   +    V    +S   G ++ EL+
Sbjct: 122 LIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFG-GQVPICAVSALQGTHIAELR 178


>AE013599-3196|AAF46721.1|  511|Drosophila melanogaster CG9841-PA
           protein.
          Length = 511

 Score = 42.3 bits (95), Expect = 7e-04
 Identities = 35/118 (29%), Positives = 52/118 (44%)
 Frame = +2

Query: 284 TIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQ 463
           T +D PGH   I+ +I G    D  +L+V A  G       K  QT E  L+   L  K+
Sbjct: 70  TFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKG-------KQTQTAE-CLIIGELLQKK 121

Query: 464 LIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNPAAVAFVPISGWHGDNMLELQ 637
           LIV +NK+D       +  L K R +   T +   +    V    +S   G ++ EL+
Sbjct: 122 LIVVINKIDVYPENQRASKLEKLRLRLAKTLEATTFG-GQVPICAVSALQGTHIAELR 178


>X80069-1|CAA56375.1|  475|Drosophila melanogaster 51KDa protein
           protein.
          Length = 475

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           CS  F   ++ V+ +D PGH   +  M+ G +  D A+L++A              QT E
Sbjct: 119 CSGNFRLVRH-VSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSE 171

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H      + +KQ+++  NK+D
Sbjct: 172 HLAAIEIMKLKQILILQNKID 192


>BT012446-1|AAS93717.1|  467|Drosophila melanogaster RE71279p
           protein.
          Length = 467

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           CS  F   ++ V+ +D PGH   +  M+ G +  D A+L++A              QT E
Sbjct: 111 CSGNFRLVRH-VSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSE 163

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H      + +KQ+++  NK+D
Sbjct: 164 HLAAIEIMKLKQILILQNKID 184


>AY061102-1|AAL28650.1|  475|Drosophila melanogaster LD09025p
           protein.
          Length = 475

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           CS  F   ++ V+ +D PGH   +  M+ G +  D A+L++A              QT E
Sbjct: 119 CSGNFRLVRH-VSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSE 171

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H      + +KQ+++  NK+D
Sbjct: 172 HLAAIEIMKLKQILILQNKID 192


>AJ290956-1|CAB93767.1|  475|Drosophila melanogaster eukaryotic
           translation initiationfactor 2 gamma subunit protein.
          Length = 475

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           CS  F   ++ V+ +D PGH   +  M+ G +  D A+L++A              QT E
Sbjct: 119 CSGNFRLVRH-VSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSE 171

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H      + +KQ+++  NK+D
Sbjct: 172 HLAAIEIMKLKQILILQNKID 192


>AE014297-1977|AAN13641.1|  467|Drosophila melanogaster CG6476-PC,
           isoform C protein.
          Length = 467

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           CS  F   ++ V+ +D PGH   +  M+ G +  D A+L++A              QT E
Sbjct: 111 CSGNFRLVRH-VSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSE 163

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H      + +KQ+++  NK+D
Sbjct: 164 HLAAIEIMKLKQILILQNKID 184


>AE014297-1976|AAF55153.1|  475|Drosophila melanogaster CG6476-PB,
           isoform B protein.
          Length = 475

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +2

Query: 248 CSRKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTRE 427
           CS  F   ++ V+ +D PGH   +  M+ G +  D A+L++A              QT E
Sbjct: 119 CSGNFRLVRH-VSFVDCPGHDILMATMLNGAAVMDAALLLIAGNES------CPQPQTSE 171

Query: 428 HALLAFTLGVKQLIVGVNKMD 490
           H      + +KQ+++  NK+D
Sbjct: 172 HLAAIEIMKLKQILILQNKID 192


>X15805-1|CAA33804.1|  844|Drosophila melanogaster protein (
           Drosophila DMEF2 genefor the translation elongation
           factor 2. ).
          Length = 844

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           R+ E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 95  REKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>AY075481-1|AAL68292.1|  844|Drosophila melanogaster RE38659p
           protein.
          Length = 844

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           R+ E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 95  REKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>AE014134-3534|AAN11135.1|  832|Drosophila melanogaster CG2238-PC,
           isoform C protein.
          Length = 832

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 32



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           R+ E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 83  REKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 126


>AE014134-3533|AAG22125.2|  832|Drosophila melanogaster CG2238-PB,
           isoform B protein.
          Length = 832

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 1   MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 32



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           R+ E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 83  REKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 126


>AE014134-3532|AAF57226.2|  844|Drosophila melanogaster CG2238-PA,
           isoform A protein.
          Length = 844

 Score = 33.9 bits (74), Expect = 0.23
 Identities = 16/32 (50%), Positives = 20/32 (62%)
 Frame = +1

Query: 25  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKCG 120
           M K++   N+ VI HVD GKST T  L+ K G
Sbjct: 13  MDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAG 44



 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +2

Query: 254 RKFETSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           R+ E   + + +ID+PGH DF   +       D A+++V   +G
Sbjct: 95  REKECKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSG 138


>AY058769-1|AAL13998.1|  949|Drosophila melanogaster SD04694p
           protein.
          Length = 949

 Score = 31.9 bits (69), Expect = 0.92
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 370
           Y + +ID+PGH DF   + T     D A+++V
Sbjct: 7   YLINLIDSPGHVDFSSEVSTAVRLCDGAIVVV 38


>AE014296-2740|AAF49461.3| 1033|Drosophila melanogaster CG33158-PB
           protein.
          Length = 1033

 Score = 31.9 bits (69), Expect = 0.92
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIV 370
           Y + +ID+PGH DF   + T     D A+++V
Sbjct: 91  YLINLIDSPGHVDFSSEVSTAVRLCDGAIVVV 122


>AE014297-3196|AAF56031.2|  692|Drosophila melanogaster CG31159-PA
           protein.
          Length = 692

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 10/24 (41%), Positives = 18/24 (75%)
 Frame = +1

Query: 49  NIVVIGHVDSGKSTTTGHLIYKCG 120
           NI ++ H+D+GK+TTT  +++  G
Sbjct: 35  NIGILAHIDAGKTTTTERMLFYAG 58


>BT023763-1|AAZ41771.1|  639|Drosophila melanogaster RE37786p
           protein.
          Length = 639

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 430
           + IID PGH DF   +       D AVL++ A  G     ++ N Q + +
Sbjct: 112 INIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQSETLTVNRQMKRY 161


>AE014134-1251|AAF52495.2|  745|Drosophila melanogaster CG4567-PA
           protein.
          Length = 745

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 16/50 (32%), Positives = 24/50 (48%)
 Frame = +2

Query: 281 VTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREH 430
           + IID PGH DF   +       D AVL++ A  G     ++ N Q + +
Sbjct: 112 INIIDTPGHVDFTVEVERALRVLDGAVLVLCAVGGVQSQTLTVNRQMKRY 161


>BT003552-1|AAO39556.1|  676|Drosophila melanogaster LP12382p
           protein.
          Length = 676

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 145 YLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 181


>AF017777-7|AAC28402.1|  679|Drosophila melanogaster waclaw protein.
          Length = 679

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 165 YLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 201


>AE014298-3127|AAF50824.2|  696|Drosophila melanogaster CG1410-PA,
           isoform A protein.
          Length = 696

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 14/37 (37%), Positives = 19/37 (51%)
 Frame = +2

Query: 275 YYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTG 385
           Y + +ID PGH DF   +    +  D  VL+V A  G
Sbjct: 165 YLLNLIDTPGHVDFSNEVSRSLAACDGVVLLVDACHG 201


>BT023767-1|AAZ41775.1| 1144|Drosophila melanogaster RE11051p
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIV 370
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


>AF143207-1|AAF36532.1| 1144|Drosophila melanogaster IF2 protein
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIV 370
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


>AE014296-661|AAF47774.2| 1144|Drosophila melanogaster CG10840-PB
           protein.
          Length = 1144

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +2

Query: 287 IIDAPGHRDFIKNMITGTSQADCAVLIV 370
           IID PGH  F      G+S  D A+L+V
Sbjct: 624 IIDTPGHESFSNLRNRGSSLCDIAILVV 651


>AE013599-3570|AAM68240.2|  539|Drosophila melanogaster CG30416-PA
           protein.
          Length = 539

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 24/106 (22%), Positives = 42/106 (39%), Gaps = 1/106 (0%)
 Frame = +2

Query: 263 ETSKYYVTIIDAPGHRDFI-KNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALL 439
           +TS    T +D    ++ + K M  G S++D    +    T   EA +  +         
Sbjct: 383 DTSNISSTDLDVYDQKESVEKEMNEGHSESDIVSTVQVKVTNRKEASVRGHHDREPKKTA 442

Query: 440 AFTLGVKQLIVGVNKMDSTEPPYVSPDLRKSRRKYPHTFKKIGYNP 577
            F   V Q+++        + P   P+ +K +R  P    K+GY P
Sbjct: 443 IFESSVSQVLI--------KKPEKKPEEKKPKRPPPKVEVKLGYPP 480


>M57496-1|AAA28983.1|  993|Drosophila melanogaster teashirt protein.
          Length = 993

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -2

Query: 474 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 376
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 364 PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 396


>BT015201-1|AAT94430.1|  683|Drosophila melanogaster RE67261p
           protein.
          Length = 683

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -2

Query: 474 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 376
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 93  PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 125


>AE014134-3546|AAS64735.1|  885|Drosophila melanogaster CG1374-PB,
           isoform B protein.
          Length = 885

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -2

Query: 474 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 376
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 295 PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 327


>AE014134-3545|AAF57236.2|  954|Drosophila melanogaster CG1374-PA,
           isoform A protein.
          Length = 954

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%)
 Frame = -2

Query: 474 PTMSCLTPRVKASKACS-RV*PFLEIPASNSPVP 376
           PT+  LT  +K SK C   V PF  +P SN+P P
Sbjct: 364 PTLEALTTHMKDSKHCGVNVPPFGNLP-SNNPQP 396


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,692,970
Number of Sequences: 53049
Number of extensions: 700834
Number of successful extensions: 1789
Number of sequences better than 10.0: 55
Number of HSP's better than 10.0 without gapping: 1624
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1762
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3273062859
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -