SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30098.Seq
         (617 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT024264-1|ABC86326.1|  208|Drosophila melanogaster IP15818p pro...   171   6e-43
AY061217-1|AAL28765.2|  221|Drosophila melanogaster LD16326p pro...   171   6e-43
AE013599-4000|AAS64772.1|  203|Drosophila melanogaster CG2746-PB...   171   6e-43
AE013599-3999|AAF47305.1|  203|Drosophila melanogaster CG2746-PA...   171   6e-43
X74776-1|CAA52784.1|  203|Drosophila melanogaster ribosomal prot...   168   5e-42
AE014297-1451|AAF54749.1| 1718|Drosophila melanogaster CG14741-P...    31   1.2  
AY118966-1|AAM50826.1|  604|Drosophila melanogaster LD44821p pro...    31   1.6  
AE014134-1460|AAN11163.1|  598|Drosophila melanogaster CG7795-PB...    31   1.6  
AE014134-1459|AAF52640.1|  643|Drosophila melanogaster CG7795-PA...    31   1.6  
AE014134-1157|AAF52432.1|  992|Drosophila melanogaster CG11323-P...    30   2.9  
AE013599-1757|AAF58345.1|  607|Drosophila melanogaster CG6209-PA...    29   5.0  
X95453-2|CAA64723.1|  980|Drosophila melanogaster homologous to ...    29   6.6  
X95453-1|CAA64722.1|  537|Drosophila melanogaster homologous to ...    29   6.6  
L23195-1|AAA60323.1| 4639|Drosophila melanogaster cytoplasmic dy...    29   6.6  
BT025964-1|ABG02208.1| 1312|Drosophila melanogaster IP16365p pro...    29   6.6  
BT021276-1|AAX33424.1|  537|Drosophila melanogaster RE44971p pro...    29   6.6  
AE014297-1115|AAN13462.1|  537|Drosophila melanogaster CG3985-PA...    29   6.6  
AE014297-1114|AAO41538.2|  981|Drosophila melanogaster CG3985-PF...    29   6.6  
AE014297-1113|AAN13463.2|  597|Drosophila melanogaster CG3985-PE...    29   6.6  
AE014297-1112|AAF54506.3| 1041|Drosophila melanogaster CG3985-PD...    29   6.6  
AE014296-904|AAN11615.1| 3388|Drosophila melanogaster CG7507-PB,...    29   6.6  
AE014296-903|AAF47942.3| 4639|Drosophila melanogaster CG7507-PA,...    29   6.6  
BT022344-1|AAY54760.1|  350|Drosophila melanogaster IP11306p pro...    28   8.8  
AE014298-2472|AAF48660.3|  322|Drosophila melanogaster CG32568-P...    28   8.8  
AE014297-541|AAO41513.1|  578|Drosophila melanogaster CG1988-PB,...    28   8.8  

>BT024264-1|ABC86326.1|  208|Drosophila melanogaster IP15818p
           protein.
          Length = 208

 Score =  171 bits (416), Expect = 6e-43
 Identities = 79/85 (92%), Positives = 83/85 (97%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MSSLKLQKRLAASV+RCGKKKVWLDPNEINEIANTNSRQNIRK+IKDGL+IKKPV VHSR
Sbjct: 6   MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSR 65

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
            RVRKNTEARRKGRHCGFGKR+GTA
Sbjct: 66  YRVRKNTEARRKGRHCGFGKRKGTA 90



 Score =  121 bits (292), Expect = 7e-28
 Identities = 59/89 (66%), Positives = 64/89 (71%)
 Frame = +3

Query: 243 KRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 422
           K   NARMP K LW                +KKIDRHLYH LYMK KGNVFKNKRVLMEY
Sbjct: 87  KGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEY 146

Query: 423 IHRKKAEKARTKMLSDQAEARRNKVKEAR 509
           IH+KKAEK R+KML+DQAEARR KV+EAR
Sbjct: 147 IHKKKAEKQRSKMLADQAEARRQKVREAR 175


>AY061217-1|AAL28765.2|  221|Drosophila melanogaster LD16326p
           protein.
          Length = 221

 Score =  171 bits (416), Expect = 6e-43
 Identities = 79/85 (92%), Positives = 83/85 (97%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MSSLKLQKRLAASV+RCGKKKVWLDPNEINEIANTNSRQNIRK+IKDGL+IKKPV VHSR
Sbjct: 19  MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSR 78

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
            RVRKNTEARRKGRHCGFGKR+GTA
Sbjct: 79  YRVRKNTEARRKGRHCGFGKRKGTA 103



 Score =  121 bits (292), Expect = 7e-28
 Identities = 59/89 (66%), Positives = 64/89 (71%)
 Frame = +3

Query: 243 KRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 422
           K   NARMP K LW                +KKIDRHLYH LYMK KGNVFKNKRVLMEY
Sbjct: 100 KGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEY 159

Query: 423 IHRKKAEKARTKMLSDQAEARRNKVKEAR 509
           IH+KKAEK R+KML+DQAEARR KV+EAR
Sbjct: 160 IHKKKAEKQRSKMLADQAEARRQKVREAR 188


>AE013599-4000|AAS64772.1|  203|Drosophila melanogaster CG2746-PB,
           isoform B protein.
          Length = 203

 Score =  171 bits (416), Expect = 6e-43
 Identities = 79/85 (92%), Positives = 83/85 (97%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MSSLKLQKRLAASV+RCGKKKVWLDPNEINEIANTNSRQNIRK+IKDGL+IKKPV VHSR
Sbjct: 1   MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
            RVRKNTEARRKGRHCGFGKR+GTA
Sbjct: 61  YRVRKNTEARRKGRHCGFGKRKGTA 85



 Score =  121 bits (292), Expect = 7e-28
 Identities = 59/89 (66%), Positives = 64/89 (71%)
 Frame = +3

Query: 243 KRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 422
           K   NARMP K LW                +KKIDRHLYH LYMK KGNVFKNKRVLMEY
Sbjct: 82  KGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEY 141

Query: 423 IHRKKAEKARTKMLSDQAEARRNKVKEAR 509
           IH+KKAEK R+KML+DQAEARR KV+EAR
Sbjct: 142 IHKKKAEKQRSKMLADQAEARRQKVREAR 170


>AE013599-3999|AAF47305.1|  203|Drosophila melanogaster CG2746-PA,
           isoform A protein.
          Length = 203

 Score =  171 bits (416), Expect = 6e-43
 Identities = 79/85 (92%), Positives = 83/85 (97%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MSSLKLQKRLAASV+RCGKKKVWLDPNEINEIANTNSRQNIRK+IKDGL+IKKPV VHSR
Sbjct: 1   MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
            RVRKNTEARRKGRHCGFGKR+GTA
Sbjct: 61  YRVRKNTEARRKGRHCGFGKRKGTA 85



 Score =  121 bits (292), Expect = 7e-28
 Identities = 59/89 (66%), Positives = 64/89 (71%)
 Frame = +3

Query: 243 KRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 422
           K   NARMP K LW                +KKIDRHLYH LYMK KGNVFKNKRVLMEY
Sbjct: 82  KGTANARMPTKLLWMQRQRVLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEY 141

Query: 423 IHRKKAEKARTKMLSDQAEARRNKVKEAR 509
           IH+KKAEK R+KML+DQAEARR KV+EAR
Sbjct: 142 IHKKKAEKQRSKMLADQAEARRQKVREAR 170


>X74776-1|CAA52784.1|  203|Drosophila melanogaster ribosomal protein
           L19 protein.
          Length = 203

 Score =  168 bits (409), Expect = 5e-42
 Identities = 78/85 (91%), Positives = 82/85 (96%)
 Frame = +1

Query: 1   MSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSR 180
           MSSLKLQKRLAASV+RCGKKKVWLDPNEINEIANTNSRQNIRK+IKDGL+IKKPV VHSR
Sbjct: 1   MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLIIKKPVVVHSR 60

Query: 181 ARVRKNTEARRKGRHCGFGKRRGTA 255
            RVRKNTEARRK RHCGFGKR+GTA
Sbjct: 61  YRVRKNTEARRKDRHCGFGKRKGTA 85



 Score =  121 bits (292), Expect = 7e-28
 Identities = 59/89 (66%), Positives = 64/89 (71%)
 Frame = +3

Query: 243 KRYCNARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNVFKNKRVLMEY 422
           K   NARMP K LW                +KKIDRHLYH LYMK KGNVFKNKRVLMEY
Sbjct: 82  KGTANARMPTKLLWMQRQPFCRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEY 141

Query: 423 IHRKKAEKARTKMLSDQAEARRNKVKEAR 509
           IH+KKAEK R+KML+DQAEARR KV+EAR
Sbjct: 142 IHKKKAEKQRSKMLADQAEARRQKVREAR 170


>AE014297-1451|AAF54749.1| 1718|Drosophila melanogaster CG14741-PA
            protein.
          Length = 1718

 Score = 31.1 bits (67), Expect = 1.2
 Identities = 19/55 (34%), Positives = 27/55 (49%)
 Frame = -2

Query: 421  YSMSTRLFLNTLPFAFM*SEWYRCLSIFLAVLYFRSNFLRTLCLCTHSSFCGIRA 257
            YS++   +L  L        +YR    FL   +++ NF  TLC C +S FCG  A
Sbjct: 1321 YSIAQFRYLERLLLVHGRWSYYRMCK-FLRYFFYK-NFAFTLCHCWYSLFCGFSA 1373


>AY118966-1|AAM50826.1|  604|Drosophila melanogaster LD44821p
           protein.
          Length = 604

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = -3

Query: 345 QSSWQFCTSGAIFLEPFVFVPIVPSVAYAHCSTSSLTKATVTTLSTCLCVF 193
           QSSW    S A+F+      PI+   A+ HC  +    ATV+T+S  L  F
Sbjct: 44  QSSWSMAGSSAVFIPG----PIITGSAHGHCHHT----ATVSTVSPQLATF 86


>AE014134-1460|AAN11163.1|  598|Drosophila melanogaster CG7795-PB,
           isoform B protein.
          Length = 598

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = -3

Query: 345 QSSWQFCTSGAIFLEPFVFVPIVPSVAYAHCSTSSLTKATVTTLSTCLCVF 193
           QSSW    S A+F+      PI+   A+ HC  +    ATV+T+S  L  F
Sbjct: 44  QSSWSMAGSSAVFIPG----PIITGSAHGHCHHT----ATVSTVSPQLATF 86


>AE014134-1459|AAF52640.1|  643|Drosophila melanogaster CG7795-PA,
           isoform A protein.
          Length = 643

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 19/51 (37%), Positives = 26/51 (50%)
 Frame = -3

Query: 345 QSSWQFCTSGAIFLEPFVFVPIVPSVAYAHCSTSSLTKATVTTLSTCLCVF 193
           QSSW    S A+F+      PI+   A+ HC  +    ATV+T+S  L  F
Sbjct: 44  QSSWSMAGSSAVFIPG----PIITGSAHGHCHHT----ATVSTVSPQLATF 86


>AE014134-1157|AAF52432.1|  992|Drosophila melanogaster CG11323-PA
           protein.
          Length = 992

 Score = 29.9 bits (64), Expect = 2.9
 Identities = 14/50 (28%), Positives = 22/50 (44%)
 Frame = +3

Query: 432 KKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRRNCCRPSLEKTKP 581
           K+A ++ T++LS   +                LPP+R+  C P L  T P
Sbjct: 776 KQAGRSITQLLSATHKRNTGGSLSGEQVQSTALPPKRQRSCGPRLSSTNP 825


>AE013599-1757|AAF58345.1|  607|Drosophila melanogaster CG6209-PA
           protein.
          Length = 607

 Score = 29.1 bits (62), Expect = 5.0
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 7/48 (14%)
 Frame = +3

Query: 429 RKKAEKARTKMLSDQA-------EARRNKVKEARSAARNVLPPRRRNC 551
           +KK+++A  K  S+QA       EA++NK +EA    +     R+++C
Sbjct: 533 KKKSQEAEKKTKSEQAALQKKCAEAKKNKAREAEKKKKTAESERKKDC 580


>X95453-2|CAA64723.1|  980|Drosophila melanogaster homologous to
           synapsin I protein.
          Length = 980

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 498 KEARSAARNVLPPRRRNCCRPSLEKTKP-RLPLRS 599
           +E R    +++  R +N CRPS+ +T P +LP RS
Sbjct: 378 EEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRS 412


>X95453-1|CAA64722.1|  537|Drosophila melanogaster homologous to
           synapsin I protein.
          Length = 537

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 498 KEARSAARNVLPPRRRNCCRPSLEKTKP-RLPLRS 599
           +E R    +++  R +N CRPS+ +T P +LP RS
Sbjct: 378 EEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRS 412


>L23195-1|AAA60323.1| 4639|Drosophila melanogaster cytoplasmic
           dynein heavy chian protein.
          Length = 4639

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 88  NEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARV 189
           N++  TNSR      IK GLV++   ++HS+ R+
Sbjct: 104 NDVHFTNSRMASLACIKRGLVVEADKSIHSQLRL 137


>BT025964-1|ABG02208.1| 1312|Drosophila melanogaster IP16365p
           protein.
          Length = 1312

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 88  NEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARV 189
           N++  TNSR      IK GLV++   ++HS+ R+
Sbjct: 104 NDVHFTNSRMASLACIKRGLVVEADKSIHSQLRL 137


>BT021276-1|AAX33424.1|  537|Drosophila melanogaster RE44971p
           protein.
          Length = 537

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 498 KEARSAARNVLPPRRRNCCRPSLEKTKP-RLPLRS 599
           +E R    +++  R +N CRPS+ +T P +LP RS
Sbjct: 378 EEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRS 412


>AE014297-1115|AAN13462.1|  537|Drosophila melanogaster CG3985-PA,
           isoform A protein.
          Length = 537

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 498 KEARSAARNVLPPRRRNCCRPSLEKTKP-RLPLRS 599
           +E R    +++  R +N CRPS+ +T P +LP RS
Sbjct: 378 EEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRS 412


>AE014297-1114|AAO41538.2|  981|Drosophila melanogaster CG3985-PF,
           isoform F protein.
          Length = 981

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 498 KEARSAARNVLPPRRRNCCRPSLEKTKP-RLPLRS 599
           +E R    +++  R +N CRPS+ +T P +LP RS
Sbjct: 378 EEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRS 412


>AE014297-1113|AAN13463.2|  597|Drosophila melanogaster CG3985-PE,
           isoform E protein.
          Length = 597

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 498 KEARSAARNVLPPRRRNCCRPSLEKTKP-RLPLRS 599
           +E R    +++  R +N CRPS+ +T P +LP RS
Sbjct: 438 EEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRS 472


>AE014297-1112|AAF54506.3| 1041|Drosophila melanogaster CG3985-PD,
           isoform D protein.
          Length = 1041

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
 Frame = +3

Query: 498 KEARSAARNVLPPRRRNCCRPSLEKTKP-RLPLRS 599
           +E R    +++  R +N CRPS+ +T P +LP RS
Sbjct: 438 EEDRRQIADLVSGRMQNVCRPSMAQTGPGKLPSRS 472


>AE014296-904|AAN11615.1| 3388|Drosophila melanogaster CG7507-PB,
           isoform B protein.
          Length = 3388

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 88  NEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARV 189
           N++  TNSR      IK GLV++   ++HS+ R+
Sbjct: 104 NDVHFTNSRMASLACIKRGLVVEADKSIHSQLRL 137


>AE014296-903|AAF47942.3| 4639|Drosophila melanogaster CG7507-PA,
           isoform A protein.
          Length = 4639

 Score = 28.7 bits (61), Expect = 6.6
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 88  NEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARV 189
           N++  TNSR      IK GLV++   ++HS+ R+
Sbjct: 104 NDVHFTNSRMASLACIKRGLVVEADKSIHSQLRL 137


>BT022344-1|AAY54760.1|  350|Drosophila melanogaster IP11306p
           protein.
          Length = 350

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = -1

Query: 545 PPSWRQYVPRGASCLLYFIAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVLEHI 387
           PPS  +Y  +   C++ F+    S + K+++ GLL L P     + TL L  I
Sbjct: 176 PPSLTKYFHQLIKCIIAFLNQYPSFIEKYVK-GLLRLWPKTSFTKVTLFLSEI 227


>AE014298-2472|AAF48660.3|  322|Drosophila melanogaster CG32568-PA
           protein.
          Length = 322

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 17/53 (32%), Positives = 27/53 (50%)
 Frame = -1

Query: 545 PPSWRQYVPRGASCLLYFIAAGLSLVAKHLRPGLLSLLPVDVLHEHTLVLEHI 387
           PPS  +Y  +   C++ F+    S + K+++ GLL L P     + TL L  I
Sbjct: 148 PPSLTKYFHQLIKCIIAFLNQYPSFIEKYVK-GLLRLWPKTSFTKVTLFLSEI 199


>AE014297-541|AAO41513.1|  578|Drosophila melanogaster CG1988-PB,
           isoform B protein.
          Length = 578

 Score = 28.3 bits (60), Expect = 8.8
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +3

Query: 429 RKKAEKARTKMLSDQAEARRNKVKEARSAARNVLPPRRRNCCRPSLEKTK 578
           RK+AE+ R +   ++ EARR   +EA+      L   +R C + + E  K
Sbjct: 295 RKRAEEERKR---EEEEARRRAEEEAKKGPEEDLCELKRQCAKMAKEARK 341


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,253,518
Number of Sequences: 53049
Number of extensions: 624153
Number of successful extensions: 2018
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 1881
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2013
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2538517050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -