SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30097.Seq
         (631 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY084124-1|AAL89862.1|  596|Drosophila melanogaster RE20574p pro...    43   3e-04
AE013599-1378|AAG22282.1|  544|Drosophila melanogaster CG8298-PB...    43   3e-04
AE013599-1377|AAF58597.1|  596|Drosophila melanogaster CG8298-PA...    43   3e-04
AY051535-1|AAK92959.1|  576|Drosophila melanogaster GH18690p pro...    40   0.003
AE014296-346|AAN11497.1|  576|Drosophila melanogaster CG7995-PE,...    40   0.003
AE014296-345|AAN11496.1|  576|Drosophila melanogaster CG7995-PD,...    40   0.003
AE014296-344|AAF47558.2|  576|Drosophila melanogaster CG7995-PC,...    40   0.003
AE014296-343|AAF47560.1|  576|Drosophila melanogaster CG7995-PB,...    40   0.003
AE014296-342|AAF47559.1|  576|Drosophila melanogaster CG7995-PA,...    40   0.003
BT001661-1|AAN71416.1|  474|Drosophila melanogaster RE46914p pro...    39   0.006
AY051456-1|AAK92880.1|  538|Drosophila melanogaster GH12641p pro...    39   0.006
AE014296-36|AAN11423.1|  474|Drosophila melanogaster CG18374-PB,...    39   0.006
AE014296-35|AAF47346.1|  538|Drosophila melanogaster CG18374-PA,...    39   0.006
AY051600-1|AAK93024.1|  487|Drosophila melanogaster GH24078p pro...    30   3.0  
AL009191-2|CAA15683.1|  487|Drosophila melanogaster EG:39E1.3 pr...    30   3.0  
AE014298-302|AAS65248.1|  487|Drosophila melanogaster CG3857-PA ...    30   3.0  
BT009937-1|AAQ22406.1| 1872|Drosophila melanogaster SD06328p pro...    29   5.2  
AE014297-117|ABI31136.1|  100|Drosophila melanogaster CG41516-PA...    29   5.2  
X56232-1|CAA39689.1|  568|Drosophila melanogaster disco gene pro...    29   6.9  
BT003295-1|AAO25055.1|  568|Drosophila melanogaster GH27656p pro...    29   6.9  
AE014298-2336|ABC67185.1|  568|Drosophila melanogaster CG9908-PB...    29   6.9  
AE014298-2335|AAF48568.1|  568|Drosophila melanogaster CG9908-PA...    29   6.9  
DQ418878-1|ABD77422.1| 1765|Drosophila melanogaster echinus spli...    28   9.1  
DQ418877-1|ABD77421.1| 1746|Drosophila melanogaster echinus spli...    28   9.1  
BT010058-1|AAQ22527.1|  865|Drosophila melanogaster LD15974p pro...    28   9.1  
AY576488-1|AAS86754.1| 1712|Drosophila melanogaster echinus prot...    28   9.1  
AY118678-1|AAM50538.1|  582|Drosophila melanogaster AT08247p pro...    28   9.1  
AL031130-3|CAA20016.1| 1761|Drosophila melanogaster EG:EG0002.3 ...    28   9.1  
AE014298-564|AAF45898.2| 1712|Drosophila melanogaster CG2904-PA ...    28   9.1  
AE014296-1825|AAF50154.2|  849|Drosophila melanogaster CG32062-P...    28   9.1  
AE014296-1824|AAF50153.2|  881|Drosophila melanogaster CG32062-P...    28   9.1  

>AY084124-1|AAL89862.1|  596|Drosophila melanogaster RE20574p
           protein.
          Length = 596

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 36/115 (31%), Positives = 48/115 (41%), Gaps = 5/115 (4%)
 Frame = -3

Query: 530 DGAE-LSSVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRV----WPTTIPSPPADTF 366
           D AE L  VQ  AD++G  + RP       LG  I AG  M+V        + +PP D F
Sbjct: 458 DYAENLHLVQFIADIIGYMLERPQTTSPAGLGVMITAGVTMKVVSLEHAVKMYTPPTDVF 517

Query: 365 LPALTNXXXXXXXXXXXEALNKCMGWTDTKNEHVNAENQIELLQFCRRDFFSSEP 201
            P  T             A+ KC+ W    N +   E  IEL  F +R+   + P
Sbjct: 518 SPTTTKNRRELLYKRWAYAVKKCLHW----NNYETYEADIEL--FAQRELDPNLP 566


>AE013599-1378|AAG22282.1|  544|Drosophila melanogaster CG8298-PB,
           isoform B protein.
          Length = 544

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 36/115 (31%), Positives = 48/115 (41%), Gaps = 5/115 (4%)
 Frame = -3

Query: 530 DGAE-LSSVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRV----WPTTIPSPPADTF 366
           D AE L  VQ  AD++G  + RP       LG  I AG  M+V        + +PP D F
Sbjct: 406 DYAENLHLVQFIADIIGYMLERPQTTSPAGLGVMITAGVTMKVVSLEHAVKMYTPPTDVF 465

Query: 365 LPALTNXXXXXXXXXXXEALNKCMGWTDTKNEHVNAENQIELLQFCRRDFFSSEP 201
            P  T             A+ KC+ W    N +   E  IEL  F +R+   + P
Sbjct: 466 SPTTTKNRRELLYKRWAYAVKKCLHW----NNYETYEADIEL--FAQRELDPNLP 514


>AE013599-1377|AAF58597.1|  596|Drosophila melanogaster CG8298-PA,
           isoform A protein.
          Length = 596

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 36/115 (31%), Positives = 48/115 (41%), Gaps = 5/115 (4%)
 Frame = -3

Query: 530 DGAE-LSSVQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRV----WPTTIPSPPADTF 366
           D AE L  VQ  AD++G  + RP       LG  I AG  M+V        + +PP D F
Sbjct: 458 DYAENLHLVQFIADIIGYMLERPQTTSPAGLGVMITAGVTMKVVSLEHAVKMYTPPTDVF 517

Query: 365 LPALTNXXXXXXXXXXXEALNKCMGWTDTKNEHVNAENQIELLQFCRRDFFSSEP 201
            P  T             A+ KC+ W    N +   E  IEL  F +R+   + P
Sbjct: 518 SPTTTKNRRELLYKRWAYAVKKCLHW----NNYETYEADIEL--FAQRELDPNLP 566


>AY051535-1|AAK92959.1|  576|Drosophila melanogaster GH18690p
           protein.
          Length = 576

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           +Q+QAD +G+PV R  +M+STA GAA+ A +A
Sbjct: 453 MQLQADTIGMPVFRSQLMDSTAFGAAMCAAQA 484



 Score = 28.7 bits (61), Expect = 6.9
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = -1

Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           VRAALE++C QTR             + +L ADG +  N++L
Sbjct: 411 VRAALESICFQTRDILECMHQECGYEINKLHADGKLTTNNLL 452


>AE014296-346|AAN11497.1|  576|Drosophila melanogaster CG7995-PE,
           isoform E protein.
          Length = 576

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           +Q+QAD +G+PV R  +M+STA GAA+ A +A
Sbjct: 453 MQLQADTIGMPVFRSQLMDSTAFGAAMCAAQA 484



 Score = 28.7 bits (61), Expect = 6.9
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = -1

Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           VRAALE++C QTR             + +L ADG +  N++L
Sbjct: 411 VRAALESICFQTRDILECMHQECGYEINKLHADGKLTTNNLL 452


>AE014296-345|AAN11496.1|  576|Drosophila melanogaster CG7995-PD,
           isoform D protein.
          Length = 576

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           +Q+QAD +G+PV R  +M+STA GAA+ A +A
Sbjct: 453 MQLQADTIGMPVFRSQLMDSTAFGAAMCAAQA 484



 Score = 28.7 bits (61), Expect = 6.9
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = -1

Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           VRAALE++C QTR             + +L ADG +  N++L
Sbjct: 411 VRAALESICFQTRDILECMHQECGYEINKLHADGKLTTNNLL 452


>AE014296-344|AAF47558.2|  576|Drosophila melanogaster CG7995-PC,
           isoform C protein.
          Length = 576

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           +Q+QAD +G+PV R  +M+STA GAA+ A +A
Sbjct: 453 MQLQADTIGMPVFRSQLMDSTAFGAAMCAAQA 484



 Score = 28.7 bits (61), Expect = 6.9
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = -1

Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           VRAALE++C QTR             + +L ADG +  N++L
Sbjct: 411 VRAALESICFQTRDILECMHQECGYEINKLHADGKLTTNNLL 452


>AE014296-343|AAF47560.1|  576|Drosophila melanogaster CG7995-PB,
           isoform B protein.
          Length = 576

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           +Q+QAD +G+PV R  +M+STA GAA+ A +A
Sbjct: 453 MQLQADTIGMPVFRSQLMDSTAFGAAMCAAQA 484



 Score = 28.7 bits (61), Expect = 6.9
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = -1

Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           VRAALE++C QTR             + +L ADG +  N++L
Sbjct: 411 VRAALESICFQTRDILECMHQECGYEINKLHADGKLTTNNLL 452


>AE014296-342|AAF47559.1|  576|Drosophila melanogaster CG7995-PA,
           isoform A protein.
          Length = 576

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 17/32 (53%), Positives = 25/32 (78%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA 414
           +Q+QAD +G+PV R  +M+STA GAA+ A +A
Sbjct: 453 MQLQADTIGMPVFRSQLMDSTAFGAAMCAAQA 484



 Score = 28.7 bits (61), Expect = 6.9
 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%)
 Frame = -1

Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSVL 509
           VRAALE++C QTR             + +L ADG +  N++L
Sbjct: 411 VRAALESICFQTRDILECMHQECGYEINKLHADGKLTTNNLL 452


>BT001661-1|AAN71416.1|  474|Drosophila melanogaster RE46914p
           protein.
          Length = 474

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 4/78 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAM----RVWPTTIPSPPADTFLPALTNXX 342
           +Q+Q+DL+GI V+R  + E+TALGAA+ A +A+    ++      S P +   P+++   
Sbjct: 381 LQLQSDLVGIQVLRAKIAETTALGAAMAAYKAVENRYQMEAPLSKSGPREAIKPSISATD 440

Query: 341 XXXXXXXXXEALNKCMGW 288
                     A+++ + W
Sbjct: 441 RNLRYQKWKMAIDRSLNW 458



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = -1

Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSV 512
           VRA LEAVC Q R            PL +L+ DGGM  N++
Sbjct: 339 VRATLEAVCFQVRDILDSMHKDCKIPLAKLMVDGGMTVNNL 379


>AY051456-1|AAK92880.1|  538|Drosophila melanogaster GH12641p
           protein.
          Length = 538

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 4/78 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAM----RVWPTTIPSPPADTFLPALTNXX 342
           +Q+Q+DL+GI V+R  + E+TALGAA+ A +A+    ++      S P +   P+++   
Sbjct: 445 LQLQSDLVGIQVLRAKIAETTALGAAMAAYKAVENRYQMEAPLSKSGPREAIKPSISATD 504

Query: 341 XXXXXXXXXEALNKCMGW 288
                     A+++ + W
Sbjct: 505 RNLRYQKWKMAIDRSLNW 522



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = -1

Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSV 512
           VRA LEAVC Q R            PL +L+ DGGM  N++
Sbjct: 403 VRATLEAVCFQVRDILDSMHKDCKIPLAKLMVDGGMTVNNL 443


>AE014296-36|AAN11423.1|  474|Drosophila melanogaster CG18374-PB,
           isoform B protein.
          Length = 474

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 4/78 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAM----RVWPTTIPSPPADTFLPALTNXX 342
           +Q+Q+DL+GI V+R  + E+TALGAA+ A +A+    ++      S P +   P+++   
Sbjct: 381 LQLQSDLVGIQVLRAKIAETTALGAAMAAYKAVENRYQMEAPLSKSGPREAIKPSISATD 440

Query: 341 XXXXXXXXXEALNKCMGW 288
                     A+++ + W
Sbjct: 441 RNLRYQKWKMAIDRSLNW 458



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = -1

Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSV 512
           VRA LEAVC Q R            PL +L+ DGGM  N++
Sbjct: 339 VRATLEAVCFQVRDILDSMHKDCKIPLAKLMVDGGMTVNNL 379


>AE014296-35|AAF47346.1|  538|Drosophila melanogaster CG18374-PA,
           isoform A protein.
          Length = 538

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 4/78 (5%)
 Frame = -3

Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAM----RVWPTTIPSPPADTFLPALTNXX 342
           +Q+Q+DL+GI V+R  + E+TALGAA+ A +A+    ++      S P +   P+++   
Sbjct: 445 LQLQSDLVGIQVLRAKIAETTALGAAMAAYKAVENRYQMEAPLSKSGPREAIKPSISATD 504

Query: 341 XXXXXXXXXEALNKCMGW 288
                     A+++ + W
Sbjct: 505 RNLRYQKWKMAIDRSLNW 522



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = -1

Query: 631 VRAALEAVCHQTR-XXXXXXXXXXAPLRQLLADGGMAQNSV 512
           VRA LEAVC Q R            PL +L+ DGGM  N++
Sbjct: 403 VRATLEAVCFQVRDILDSMHKDCKIPLAKLMVDGGMTVNNL 443


>AY051600-1|AAK93024.1|  487|Drosophila melanogaster GH24078p
           protein.
          Length = 487

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 4/80 (5%)
 Frame = +1

Query: 391 IVVGHTRIARPATMAA-PRAVLSIMRG--RMTGIPSKSACICTELSSAPSLRRRGVAS-G 558
           ++V  T   RPA     P A  ++++G  +++ +PS S C    +SS P+ R +G  S G
Sbjct: 86  MIVNRTGEVRPADRCQMPLAGGALVQGSGQLSAVPSSSVCAAL-VSSVPTSRDKGSCSGG 144

Query: 559 ARSLQPSRPPRRASGDTRPP 618
           A +   S     A  + +PP
Sbjct: 145 AGTAGTSAGAPNALQELQPP 164


>AL009191-2|CAA15683.1|  487|Drosophila melanogaster EG:39E1.3
           protein.
          Length = 487

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 4/80 (5%)
 Frame = +1

Query: 391 IVVGHTRIARPATMAA-PRAVLSIMRG--RMTGIPSKSACICTELSSAPSLRRRGVAS-G 558
           ++V  T   RPA     P A  ++++G  +++ +PS S C    +SS P+ R +G  S G
Sbjct: 86  MIVNRTGEVRPADRCQMPLAGGALVQGSGQLSAVPSSSVCAAL-VSSVPTSRDKGSCSGG 144

Query: 559 ARSLQPSRPPRRASGDTRPP 618
           A +   S     A  + +PP
Sbjct: 145 AGTAGTSAGAPNALQELQPP 164


>AE014298-302|AAS65248.1|  487|Drosophila melanogaster CG3857-PA
           protein.
          Length = 487

 Score = 29.9 bits (64), Expect = 3.0
 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 4/80 (5%)
 Frame = +1

Query: 391 IVVGHTRIARPATMAA-PRAVLSIMRG--RMTGIPSKSACICTELSSAPSLRRRGVAS-G 558
           ++V  T   RPA     P A  ++++G  +++ +PS S C    +SS P+ R +G  S G
Sbjct: 86  MIVNRTGEVRPADRCQMPLAGGALVQGSGQLSAVPSSSVCAAL-VSSVPTSRDKGSCSGG 144

Query: 559 ARSLQPSRPPRRASGDTRPP 618
           A +   S     A  + +PP
Sbjct: 145 AGTAGTSAGAPNALQELQPP 164


>BT009937-1|AAQ22406.1| 1872|Drosophila melanogaster SD06328p protein.
          Length = 1872

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 9/59 (15%)
 Frame = +1

Query: 478  GIPSKSACICTELSSAPS-LRRRGVASGARSLQPSRPPRRAS---GDTR-----PPARP 627
            GIP+        ++ +PS     G  S +RSL PSR   R S   GD+R     PP+RP
Sbjct: 845  GIPASGRSSRASITRSPSRTMNAGSRSPSRSLHPSRTSSRESGRPGDSRSASRGPPSRP 903


>AE014297-117|ABI31136.1|  100|Drosophila melanogaster CG41516-PA
           protein.
          Length = 100

 Score = 29.1 bits (62), Expect = 5.2
 Identities = 17/57 (29%), Positives = 25/57 (43%)
 Frame = +1

Query: 418 RPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPP 588
           R  T AAP    ++  G+  G+P            A +  + G+ SGA+ L P  PP
Sbjct: 32  RGLTQAAPFPQPAVREGKFEGLPPLQKQKEPTNKRAHARAKSGLVSGAQKLDPRIPP 88


>X56232-1|CAA39689.1|  568|Drosophila melanogaster disco gene
           protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = -3

Query: 467 PLMMESTALGAAIVAGRAMRVWPTTIPSPP 378
           P+    TA  AA VAGR    +P  +P PP
Sbjct: 169 PVFSPGTAAAAAAVAGRLPVAFPGLLPPPP 198


>BT003295-1|AAO25055.1|  568|Drosophila melanogaster GH27656p
           protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = -3

Query: 467 PLMMESTALGAAIVAGRAMRVWPTTIPSPP 378
           P+    TA  AA VAGR    +P  +P PP
Sbjct: 169 PVFSPGTAAAAAAVAGRLPVAFPGLLPPPP 198


>AE014298-2336|ABC67185.1|  568|Drosophila melanogaster CG9908-PB,
           isoform B protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = -3

Query: 467 PLMMESTALGAAIVAGRAMRVWPTTIPSPP 378
           P+    TA  AA VAGR    +P  +P PP
Sbjct: 169 PVFSPGTAAAAAAVAGRLPVAFPGLLPPPP 198


>AE014298-2335|AAF48568.1|  568|Drosophila melanogaster CG9908-PA,
           isoform A protein.
          Length = 568

 Score = 28.7 bits (61), Expect = 6.9
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = -3

Query: 467 PLMMESTALGAAIVAGRAMRVWPTTIPSPP 378
           P+    TA  AA VAGR    +P  +P PP
Sbjct: 169 PVFSPGTAAAAAAVAGRLPVAFPGLLPPPP 198


>DQ418878-1|ABD77422.1| 1765|Drosophila melanogaster echinus splice
           form 3 protein.
          Length = 1765

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +1

Query: 382 GLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPS 531
           G G+ +GH  +A PA  +AP    S++R  +T  P K +   T  +  P+
Sbjct: 419 GNGVGIGHVDVAMPA--SAPSIAGSVVRRAVTPSPEKPSLGNTRRAITPT 466


>DQ418877-1|ABD77421.1| 1746|Drosophila melanogaster echinus splice
           form 1 protein.
          Length = 1746

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +1

Query: 382 GLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPS 531
           G G+ +GH  +A PA  +AP    S++R  +T  P K +   T  +  P+
Sbjct: 400 GNGVGIGHVDVAMPA--SAPSIAGSVVRRAVTPSPEKPSLGNTRRAITPT 447


>BT010058-1|AAQ22527.1|  865|Drosophila melanogaster LD15974p
           protein.
          Length = 865

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 20/58 (34%), Positives = 27/58 (46%)
 Frame = +1

Query: 421 PATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRR 594
           PA+ +   A L+      +GI S SA + T LSSA    +   A  A SL     P+R
Sbjct: 321 PASTSQVIAHLNAAAAAASGIVSPSANVATSLSSALVPAQSVAAVAAASLDAKSQPKR 378


>AY576488-1|AAS86754.1| 1712|Drosophila melanogaster echinus
           protein.
          Length = 1712

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +1

Query: 382 GLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPS 531
           G G+ +GH  +A PA  +AP    S++R  +T  P K +   T  +  P+
Sbjct: 366 GNGVGIGHVDVAMPA--SAPSIAGSVVRRAVTPSPEKPSLGNTRRAITPT 413


>AY118678-1|AAM50538.1|  582|Drosophila melanogaster AT08247p
           protein.
          Length = 582

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 20/58 (34%), Positives = 27/58 (46%)
 Frame = +1

Query: 421 PATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRR 594
           PA+ +   A L+      +GI S SA + T LSSA    +   A  A SL     P+R
Sbjct: 141 PASTSQVIAHLNAAAAAASGIVSPSANVATSLSSALVPAQSVAAVAAASLDAKSQPKR 198


>AL031130-3|CAA20016.1| 1761|Drosophila melanogaster EG:EG0002.3
           protein.
          Length = 1761

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +1

Query: 382 GLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPS 531
           G G+ +GH  +A PA  +AP    S++R  +T  P K +   T  +  P+
Sbjct: 415 GNGVGIGHVDVAMPA--SAPSIAGSVVRRAVTPSPEKPSLGNTRRAITPT 462


>AE014298-564|AAF45898.2| 1712|Drosophila melanogaster CG2904-PA
           protein.
          Length = 1712

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 16/50 (32%), Positives = 26/50 (52%)
 Frame = +1

Query: 382 GLGIVVGHTRIARPATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPS 531
           G G+ +GH  +A PA  +AP    S++R  +T  P K +   T  +  P+
Sbjct: 366 GNGVGIGHVDVAMPA--SAPSIAGSVVRRAVTPSPEKPSLGNTRRAITPT 413


>AE014296-1825|AAF50154.2|  849|Drosophila melanogaster CG32062-PB,
           isoform B protein.
          Length = 849

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 20/58 (34%), Positives = 27/58 (46%)
 Frame = +1

Query: 421 PATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRR 594
           PA+ +   A L+      +GI S SA + T LSSA    +   A  A SL     P+R
Sbjct: 379 PASTSQVIAHLNAAAAAASGIVSPSANVATSLSSALVPAQSVAAVAAASLDAKSQPKR 436


>AE014296-1824|AAF50153.2|  881|Drosophila melanogaster CG32062-PD,
           isoform D protein.
          Length = 881

 Score = 28.3 bits (60), Expect = 9.1
 Identities = 20/58 (34%), Positives = 27/58 (46%)
 Frame = +1

Query: 421 PATMAAPRAVLSIMRGRMTGIPSKSACICTELSSAPSLRRRGVASGARSLQPSRPPRR 594
           PA+ +   A L+      +GI S SA + T LSSA    +   A  A SL     P+R
Sbjct: 379 PASTSQVIAHLNAAAAAASGIVSPSANVATSLSSALVPAQSVAAVAAASLDAKSQPKR 436


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,131,444
Number of Sequences: 53049
Number of extensions: 689623
Number of successful extensions: 1782
Number of sequences better than 10.0: 31
Number of HSP's better than 10.0 without gapping: 1656
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1779
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2621070450
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -