SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30090.Seq
         (437 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U40226-1|AAB01760.1|   76|Drosophila melanogaster L43 protein.         60   1e-09
AE013599-3176|AAF46708.1|   76|Drosophila melanogaster CG10071-P...    60   1e-09
AE013599-3175|AAM70864.1|   76|Drosophila melanogaster CG10071-P...    60   1e-09
AE013599-3174|AAM70863.1|   76|Drosophila melanogaster CG10071-P...    60   1e-09
AY075553-1|AAL68360.1|   56|Drosophila melanogaster RH58777p pro...    58   4e-09
AY129464-1|AAM76206.1|  981|Drosophila melanogaster SD10723p pro...    29   3.7  
AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-P...    29   3.7  
AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-P...    29   3.7  

>U40226-1|AAB01760.1|   76|Drosophila melanogaster L43 protein.
          Length = 76

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 30/65 (46%), Positives = 41/65 (63%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRXT*SQPSNSRGR 344
           MAK  NHTNHNQN+KAHRNGIK+P + RHE  L     F   + +AR+   S+  + + R
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59

Query: 345 LREKL 359
             E++
Sbjct: 60  YNERI 64


>AE013599-3176|AAF46708.1|   76|Drosophila melanogaster CG10071-PC,
           isoform C protein.
          Length = 76

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 30/65 (46%), Positives = 41/65 (63%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRXT*SQPSNSRGR 344
           MAK  NHTNHNQN+KAHRNGIK+P + RHE  L     F   + +AR+   S+  + + R
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59

Query: 345 LREKL 359
             E++
Sbjct: 60  YNERI 64


>AE013599-3175|AAM70864.1|   76|Drosophila melanogaster CG10071-PB,
           isoform B protein.
          Length = 76

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 30/65 (46%), Positives = 41/65 (63%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRXT*SQPSNSRGR 344
           MAK  NHTNHNQN+KAHRNGIK+P + RHE  L     F   + +AR+   S+  + + R
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59

Query: 345 LREKL 359
             E++
Sbjct: 60  YNERI 64


>AE013599-3174|AAM70863.1|   76|Drosophila melanogaster CG10071-PA,
           isoform A protein.
          Length = 76

 Score = 60.1 bits (139), Expect = 1e-09
 Identities = 30/65 (46%), Positives = 41/65 (63%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRXT*SQPSNSRGR 344
           MAK  NHTNHNQN+KAHRNGIK+P + RHE  L     F   + +AR+   S+  + + R
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59

Query: 345 LREKL 359
             E++
Sbjct: 60  YNERI 64


>AY075553-1|AAL68360.1|   56|Drosophila melanogaster RH58777p
           protein.
          Length = 56

 Score = 58.4 bits (135), Expect = 4e-09
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = +3

Query: 165 MAKXXNHTNHNQNRKAHRNGIKKPRKTRHEPPL 263
           MAK  NHTNHNQN+KAHRNGIK+P + RHE  L
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTL 33


>AY129464-1|AAM76206.1|  981|Drosophila melanogaster SD10723p
           protein.
          Length = 981

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +2

Query: 197 PEPQSSQKWYQKAKEDQARTTLGMDP 274
           P PQ  Q+ +QK K+ Q +  LGM P
Sbjct: 346 PSPQQQQQAHQKTKQLQQQQHLGMSP 371


>AE014298-1457|AAN09261.3| 2309|Drosophila melanogaster CG17255-PB,
            isoform B protein.
          Length = 2309

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +2

Query: 197  PEPQSSQKWYQKAKEDQARTTLGMDP 274
            P PQ  Q+ +QK K+ Q +  LGM P
Sbjct: 1674 PSPQQQQQAHQKTKQLQQQQHLGMSP 1699


>AE014298-1456|AAF46591.4| 2309|Drosophila melanogaster CG17255-PA,
            isoform A protein.
          Length = 2309

 Score = 28.7 bits (61), Expect = 3.7
 Identities = 12/26 (46%), Positives = 16/26 (61%)
 Frame = +2

Query: 197  PEPQSSQKWYQKAKEDQARTTLGMDP 274
            P PQ  Q+ +QK K+ Q +  LGM P
Sbjct: 1674 PSPQQQQQAHQKTKQLQQQQHLGMSP 1699


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,098,250
Number of Sequences: 53049
Number of extensions: 248947
Number of successful extensions: 676
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 647
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 672
length of database: 24,988,368
effective HSP length: 78
effective length of database: 20,850,546
effective search space used: 1396986582
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -