SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30059.Seq
         (702 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY075573-1|AAR82741.1|  332|Drosophila melanogaster SD03439p pro...    72   9e-13
AE014134-160|AAF51451.1|  454|Drosophila melanogaster CG3862-PA ...    72   9e-13

>AY075573-1|AAR82741.1|  332|Drosophila melanogaster SD03439p
           protein.
          Length = 332

 Score = 71.7 bits (168), Expect = 9e-13
 Identities = 33/81 (40%), Positives = 48/81 (59%)
 Frame = +2

Query: 254 HVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITNIACGYGFTVASI 433
           +VWGF ETGALG+                 +V HP R  F+   +IT++A GYGFTV ++
Sbjct: 51  YVWGFQETGALGLQT----NVKKAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFTVYAV 106

Query: 434 KTSEQHKVFGTGINTDSQIGY 496
              +   +FG+G+NTDSQ+G+
Sbjct: 107 NRDDGETLFGSGLNTDSQLGF 127


>AE014134-160|AAF51451.1|  454|Drosophila melanogaster CG3862-PA
           protein.
          Length = 454

 Score = 71.7 bits (168), Expect = 9e-13
 Identities = 33/81 (40%), Positives = 48/81 (59%)
 Frame = +2

Query: 254 HVWGFAETGALGIHLPRXXXXXXXXXXXXXLVWHPMRSSFAERFDITNIACGYGFTVASI 433
           +VWGF ETGALG+                 +V HP R  F+   +IT++A GYGFTV ++
Sbjct: 47  YVWGFQETGALGLQT----NVKKAKERYTEMVHHPTRLQFSNNNEITDVAAGYGFTVYAV 102

Query: 434 KTSEQHKVFGTGINTDSQIGY 496
              +   +FG+G+NTDSQ+G+
Sbjct: 103 NRDDGETLFGSGLNTDSQLGF 123


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,723,208
Number of Sequences: 53049
Number of extensions: 588480
Number of successful extensions: 1379
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1333
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1377
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3087795150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -