SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30044.Seq
         (443 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U40226-1|AAB01760.1|   76|Drosophila melanogaster L43 protein.         65   4e-11
AE013599-3176|AAF46708.1|   76|Drosophila melanogaster CG10071-P...    65   4e-11
AE013599-3175|AAM70864.1|   76|Drosophila melanogaster CG10071-P...    65   4e-11
AE013599-3174|AAM70863.1|   76|Drosophila melanogaster CG10071-P...    65   4e-11
AY075553-1|AAL68360.1|   56|Drosophila melanogaster RH58777p pro...    63   2e-10
AE013599-1923|AAF58230.1| 3257|Drosophila melanogaster CG12864-P...    29   3.8  
AE013599-1922|AAO41391.1| 1633|Drosophila melanogaster CG12864-P...    29   3.8  
AF145661-1|AAD38636.1| 1189|Drosophila melanogaster BcDNA.GH1064...    27   8.7  
AE014296-847|AAF47899.1|  604|Drosophila melanogaster CG15020-PA...    27   8.7  

>U40226-1|AAB01760.1|   76|Drosophila melanogaster L43 protein.
          Length = 76

 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 1/73 (1%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRVT*SQPSNSRGR 344
           MAKSKNHTNHNQN+KAHRNGIK+P + RHE  L     F   + +AR+   S+  + + R
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59

Query: 345 LREKL-PEKQRPR 380
             E++  +K +P+
Sbjct: 60  YNERIASQKGKPK 72


>AE013599-3176|AAF46708.1|   76|Drosophila melanogaster CG10071-PC,
           isoform C protein.
          Length = 76

 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 1/73 (1%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRVT*SQPSNSRGR 344
           MAKSKNHTNHNQN+KAHRNGIK+P + RHE  L     F   + +AR+   S+  + + R
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59

Query: 345 LREKL-PEKQRPR 380
             E++  +K +P+
Sbjct: 60  YNERIASQKGKPK 72


>AE013599-3175|AAM70864.1|   76|Drosophila melanogaster CG10071-PB,
           isoform B protein.
          Length = 76

 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 1/73 (1%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRVT*SQPSNSRGR 344
           MAKSKNHTNHNQN+KAHRNGIK+P + RHE  L     F   + +AR+   S+  + + R
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59

Query: 345 LREKL-PEKQRPR 380
             E++  +K +P+
Sbjct: 60  YNERIASQKGKPK 72


>AE013599-3174|AAM70863.1|   76|Drosophila melanogaster CG10071-PA,
           isoform A protein.
          Length = 76

 Score = 65.3 bits (152), Expect = 4e-11
 Identities = 34/73 (46%), Positives = 48/73 (65%), Gaps = 1/73 (1%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPLAWIQNF*GIKGFARRVT*SQPSNSRGR 344
           MAKSKNHTNHNQN+KAHRNGIK+P + RHE  L     F   + +AR+   S+  + + R
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREESVK-R 59

Query: 345 LREKL-PEKQRPR 380
             E++  +K +P+
Sbjct: 60  YNERIASQKGKPK 72


>AY075553-1|AAL68360.1|   56|Drosophila melanogaster RH58777p
           protein.
          Length = 56

 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 26/33 (78%), Positives = 29/33 (87%)
 Frame = +3

Query: 165 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEPPL 263
           MAKSKNHTNHNQN+KAHRNGIK+P + RHE  L
Sbjct: 1   MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTL 33


>AE013599-1923|AAF58230.1| 3257|Drosophila melanogaster CG12864-PA,
            isoform A protein.
          Length = 3257

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +3

Query: 135  FPLQD*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTR 248
            FP+QD ++ KM+K + H N  +N K  +   K   + R
Sbjct: 2256 FPVQDAEIEKMSKGRGHQNAVKNTKTEQPKSKPKTEVR 2293


>AE013599-1922|AAO41391.1| 1633|Drosophila melanogaster CG12864-PB,
           isoform B protein.
          Length = 1633

 Score = 28.7 bits (61), Expect = 3.8
 Identities = 13/38 (34%), Positives = 21/38 (55%)
 Frame = +3

Query: 135 FPLQD*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTR 248
           FP+QD ++ KM+K + H N  +N K  +   K   + R
Sbjct: 632 FPVQDAEIEKMSKGRGHQNAVKNTKTEQPKSKPKTEVR 669


>AF145661-1|AAD38636.1| 1189|Drosophila melanogaster BcDNA.GH10646
            protein.
          Length = 1189

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 11/28 (39%), Positives = 17/28 (60%)
 Frame = +1

Query: 73   NKYFKIE*AIRCVGIYSNDFIFLYRIEN 156
            N ++  +   RCV ++ +D  FLYRI N
Sbjct: 1079 NDFYVCDFKGRCVAVFQDDGTFLYRIGN 1106


>AE014296-847|AAF47899.1|  604|Drosophila melanogaster CG15020-PA
           protein.
          Length = 604

 Score = 27.5 bits (58), Expect = 8.7
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = -3

Query: 222 HFCELCGFGYDLYDSLTLPF 163
           HF   C +GYD + ++T PF
Sbjct: 313 HFKVTCEYGYDFWKTVTFPF 332


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,661,601
Number of Sequences: 53049
Number of extensions: 267119
Number of successful extensions: 818
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 793
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 814
length of database: 24,988,368
effective HSP length: 78
effective length of database: 20,850,546
effective search space used: 1438687674
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -