SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30018.Seq
         (825 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT016143-1|AAV37028.1| 1240|Drosophila melanogaster AT25839p pro...    34   0.27 
AE013599-727|AAF59033.1| 1240|Drosophila melanogaster CG8266-PA,...    34   0.27 
AE013599-726|AAM71085.1| 1241|Drosophila melanogaster CG8266-PB,...    34   0.27 
AY084143-1|AAL89881.1|  620|Drosophila melanogaster RE25260p pro...    30   3.3  
AE013599-737|AAF59028.2|  620|Drosophila melanogaster CG30349-PA...    30   3.3  
AE014298-3106|AAF50837.1| 1713|Drosophila melanogaster CG1718-PA...    29   7.7  

>BT016143-1|AAV37028.1| 1240|Drosophila melanogaster AT25839p
           protein.
          Length = 1240

 Score = 33.9 bits (74), Expect = 0.27
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 11/110 (10%)
 Frame = +1

Query: 250 NNQAKIINVW------VPAKHFSAK---VTALDWSRKYG--LYSCTKDSRVYEWNIEDGS 396
           ++QA ++ +W       PAK +      V  + W  +    + SC KD+R+Y WN    +
Sbjct: 228 DDQAPVVQLWDLRYATAPAKTYQIHERGVLGMSWCLQDNDLMVSCGKDNRIYCWN---PN 284

Query: 397 VKQTYNISIENNTKQGSHINAIKIIPHNPAPAIPVLSTGIISAQSLEGFT 546
            K      +       S  + ++  P NPA        G +S  SL G T
Sbjct: 285 TKIPEGEILSEVATTASWYSDVQFCPRNPALIASASLEGAVSIYSLHGGT 334


>AE013599-727|AAF59033.1| 1240|Drosophila melanogaster CG8266-PA,
           isoform A protein.
          Length = 1240

 Score = 33.9 bits (74), Expect = 0.27
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 11/110 (10%)
 Frame = +1

Query: 250 NNQAKIINVW------VPAKHFSAK---VTALDWSRKYG--LYSCTKDSRVYEWNIEDGS 396
           ++QA ++ +W       PAK +      V  + W  +    + SC KD+R+Y WN    +
Sbjct: 228 DDQAPVVQLWDLRYATAPAKTYQIHERGVLGMSWCLQDNDLMVSCGKDNRIYCWN---PN 284

Query: 397 VKQTYNISIENNTKQGSHINAIKIIPHNPAPAIPVLSTGIISAQSLEGFT 546
            K      +       S  + ++  P NPA        G +S  SL G T
Sbjct: 285 TKIPEGEILSEVATTASWYSDVQFCPRNPALIASASLEGAVSIYSLHGGT 334


>AE013599-726|AAM71085.1| 1241|Drosophila melanogaster CG8266-PB,
           isoform B protein.
          Length = 1241

 Score = 33.9 bits (74), Expect = 0.27
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 11/110 (10%)
 Frame = +1

Query: 250 NNQAKIINVW------VPAKHFSAK---VTALDWSRKYG--LYSCTKDSRVYEWNIEDGS 396
           ++QA ++ +W       PAK +      V  + W  +    + SC KD+R+Y WN    +
Sbjct: 228 DDQAPVVQLWDLRYATAPAKTYQIHERGVLGMSWCLQDNDLMVSCGKDNRIYCWN---PN 284

Query: 397 VKQTYNISIENNTKQGSHINAIKIIPHNPAPAIPVLSTGIISAQSLEGFT 546
            K      +       S  + ++  P NPA        G +S  SL G T
Sbjct: 285 TKIPEGEILSEVATTASWYSDVQFCPRNPALIASASLEGAVSIYSLHGGT 334


>AY084143-1|AAL89881.1|  620|Drosophila melanogaster RE25260p
           protein.
          Length = 620

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 23/85 (27%), Positives = 33/85 (38%)
 Frame = +2

Query: 11  STITXXGXXKXSXTETXVXXQXXXPXLHLTSPPTCLQWTTVSQSVSNLKGXXXXXXXXXX 190
           +++   G  +   TET    Q   P L L+   T L W  V+   S  K           
Sbjct: 20  ASVDESGVLRIWNTETNTLYQEFTPNLQLSGSCTALTWVLVAG--SRPKKSRKSLQAQDA 77

Query: 191 XXXXQCIXLGTTNGKLLIYSIIKRK 265
                 I LGT  G ++IYS+ + K
Sbjct: 78  AGDQLHIALGTYKGSVVIYSLAEGK 102


>AE013599-737|AAF59028.2|  620|Drosophila melanogaster CG30349-PA
           protein.
          Length = 620

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 23/85 (27%), Positives = 33/85 (38%)
 Frame = +2

Query: 11  STITXXGXXKXSXTETXVXXQXXXPXLHLTSPPTCLQWTTVSQSVSNLKGXXXXXXXXXX 190
           +++   G  +   TET    Q   P L L+   T L W  V+   S  K           
Sbjct: 20  ASVDESGVLRIWNTETNTLYQEFTPNLQLSGSCTALTWVLVAG--SRPKKSRKSLQAQDA 77

Query: 191 XXXXQCIXLGTTNGKLLIYSIIKRK 265
                 I LGT  G ++IYS+ + K
Sbjct: 78  AGDQLHIALGTYKGSVVIYSLAEGK 102


>AE014298-3106|AAF50837.1| 1713|Drosophila melanogaster CG1718-PA
            protein.
          Length = 1713

 Score = 29.1 bits (62), Expect = 7.7
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +1

Query: 295  FSAKVTALDWSRKYGLYSCTKDSRVYEWNIEDGSVKQT 408
            F   +T + WSR +GL    +D    + N+ED SV QT
Sbjct: 1659 FYIPLTGVKWSRIFGLMESNRD----QLNVEDYSVSQT 1692


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,457,613
Number of Sequences: 53049
Number of extensions: 638426
Number of successful extensions: 1333
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1293
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1331
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3901127880
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -