SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= psV30011.Seq
         (628 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U49721-1|AAC16108.1|  218|Drosophila melanogaster QM homolog pro...   177   1e-44
AY070910-1|AAL48532.1|  218|Drosophila melanogaster RE02339p pro...   177   1e-44
AE014296-3758|AAF45440.2|  231|Drosophila melanogaster CG17521-P...   177   1e-44
AE014296-3757|AAG22453.3|  237|Drosophila melanogaster CG17521-P...   177   1e-44
BT003580-1|AAO39584.1|  197|Drosophila melanogaster LD24589p pro...   140   1e-33
AE014297-4823|AAF57207.1| 1844|Drosophila melanogaster CG1976-PA...    29   5.1  

>U49721-1|AAC16108.1|  218|Drosophila melanogaster QM homolog
           protein.
          Length = 218

 Score =  177 bits (431), Expect = 1e-44
 Identities = 99/171 (57%), Positives = 114/171 (66%), Gaps = 7/171 (4%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPDPKIRIFDLG+  A V+DFPLCVHLVSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR---*DFTLSTLSASIKCYHALELIXSRLGCVVR-- 345
           ALEAGRICCN YLVK CG DQFHIR     F +  ++  + C  A  L     G   +  
Sbjct: 64  ALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQ 123

Query: 346 --LASLRVL*HVFALDXXSCPCGSSDRWKAQVIEXLRRRQVSSSPDVQKIY 492
             +A +R+   + ++        SSDR+KAQVIE LRR +    P  QKIY
Sbjct: 124 GTVARVRIGQPIMSV-------RSSDRYKAQVIEALRRAKF-KFPGRQKIY 166



 Score =  122 bits (293), Expect = 5e-28
 Identities = 64/97 (65%), Positives = 71/97 (73%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           MRLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARVRIGQ IMSVR   + +   
Sbjct: 89  MRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQV 148

Query: 435 HRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
              +     FKFPGR K    K+ GFTKYER+ + +L
Sbjct: 149 IE-ALRRAKFKFPGRQKIYVSKKWGFTKYERERYEEL 184


>AY070910-1|AAL48532.1|  218|Drosophila melanogaster RE02339p
           protein.
          Length = 218

 Score =  177 bits (431), Expect = 1e-44
 Identities = 99/171 (57%), Positives = 114/171 (66%), Gaps = 7/171 (4%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPDPKIRIFDLG+  A V+DFPLCVHLVSDEYEQLSSE
Sbjct: 4   RPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSE 63

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR---*DFTLSTLSASIKCYHALELIXSRLGCVVR-- 345
           ALEAGRICCN YLVK CG DQFHIR     F +  ++  + C  A  L     G   +  
Sbjct: 64  ALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQ 123

Query: 346 --LASLRVL*HVFALDXXSCPCGSSDRWKAQVIEXLRRRQVSSSPDVQKIY 492
             +A +R+   + ++        SSDR+KAQVIE LRR +    P  QKIY
Sbjct: 124 GTVARVRIGQPIMSV-------RSSDRYKAQVIEALRRAKF-KFPGRQKIY 166



 Score =  122 bits (293), Expect = 5e-28
 Identities = 64/97 (65%), Positives = 71/97 (73%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           MRLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARVRIGQ IMSVR   + +   
Sbjct: 89  MRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQV 148

Query: 435 HRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
              +     FKFPGR K    K+ GFTKYER+ + +L
Sbjct: 149 IE-ALRRAKFKFPGRQKIYVSKKWGFTKYERERYEEL 184


>AE014296-3758|AAF45440.2|  231|Drosophila melanogaster CG17521-PA,
           isoform A protein.
          Length = 231

 Score =  177 bits (431), Expect = 1e-44
 Identities = 99/171 (57%), Positives = 114/171 (66%), Gaps = 7/171 (4%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPDPKIRIFDLG+  A V+DFPLCVHLVSDEYEQLSSE
Sbjct: 17  RPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSE 76

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR---*DFTLSTLSASIKCYHALELIXSRLGCVVR-- 345
           ALEAGRICCN YLVK CG DQFHIR     F +  ++  + C  A  L     G   +  
Sbjct: 77  ALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQ 136

Query: 346 --LASLRVL*HVFALDXXSCPCGSSDRWKAQVIEXLRRRQVSSSPDVQKIY 492
             +A +R+   + ++        SSDR+KAQVIE LRR +    P  QKIY
Sbjct: 137 GTVARVRIGQPIMSV-------RSSDRYKAQVIEALRRAKF-KFPGRQKIY 179



 Score =  122 bits (293), Expect = 5e-28
 Identities = 64/97 (65%), Positives = 71/97 (73%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           MRLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARVRIGQ IMSVR   + +   
Sbjct: 102 MRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQV 161

Query: 435 HRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
              +     FKFPGR K    K+ GFTKYER+ + +L
Sbjct: 162 IE-ALRRAKFKFPGRQKIYVSKKWGFTKYERERYEEL 197


>AE014296-3757|AAG22453.3|  237|Drosophila melanogaster CG17521-PB,
           isoform B protein.
          Length = 237

 Score =  177 bits (431), Expect = 1e-44
 Identities = 99/171 (57%), Positives = 114/171 (66%), Gaps = 7/171 (4%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPDPKIRIFDLG+  A V+DFPLCVHLVSDEYEQLSSE
Sbjct: 23  RPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSE 82

Query: 181 ALEAGRICCNXYLVKNCGXDQFHIR---*DFTLSTLSASIKCYHALELIXSRLGCVVR-- 345
           ALEAGRICCN YLVK CG DQFHIR     F +  ++  + C  A  L     G   +  
Sbjct: 83  ALEAGRICCNKYLVKYCGKDQFHIRMRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQ 142

Query: 346 --LASLRVL*HVFALDXXSCPCGSSDRWKAQVIEXLRRRQVSSSPDVQKIY 492
             +A +R+   + ++        SSDR+KAQVIE LRR +    P  QKIY
Sbjct: 143 GTVARVRIGQPIMSV-------RSSDRYKAQVIEALRRAKF-KFPGRQKIY 185



 Score =  122 bits (293), Expect = 5e-28
 Identities = 64/97 (65%), Positives = 71/97 (73%)
 Frame = +3

Query: 255 MRLHPFHVIRINKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTG 434
           MRLHPFHVIRINKMLSCAGAD LQTGMR AFGKPQGTVARVRIGQ IMSVR   + +   
Sbjct: 108 MRLHPFHVIRINKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQV 167

Query: 435 HRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDEFXKL 545
              +     FKFPGR K    K+ GFTKYER+ + +L
Sbjct: 168 IE-ALRRAKFKFPGRQKIYVSKKWGFTKYERERYEEL 203


>BT003580-1|AAO39584.1|  197|Drosophila melanogaster LD24589p
           protein.
          Length = 197

 Score =  140 bits (340), Expect = 1e-33
 Identities = 63/73 (86%), Positives = 65/73 (89%)
 Frame = +1

Query: 1   RPARCYRYXKNKPYPKSRXXRGVPDPKIRIFDLGKXXAXVDDFPLCVHLVSDEYEQLSSE 180
           RPARCYRY KNKPYPKSR  RGVPDPKIRIFDLG+  A V+DFPLCVHLVSDEYEQLSSE
Sbjct: 10  RPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGRKKATVEDFPLCVHLVSDEYEQLSSE 69

Query: 181 ALEAGRICCNXYL 219
           ALEAGRICCN  L
Sbjct: 70  ALEAGRICCNKML 82



 Score = 97.9 bits (233), Expect = 1e-20
 Identities = 53/86 (61%), Positives = 60/86 (69%)
 Frame = +3

Query: 288 NKMLSCAGADXLQTGMRXAFGKPQGTVARVRIGQXIMSVRL**QVEGTGHRGSAPSPSFK 467
           NKMLSCAGAD LQTGMR AFGKPQGTVARVRIGQ IMSVR   + +      +     FK
Sbjct: 79  NKMLSCAGADRLQTGMRGAFGKPQGTVARVRIGQPIMSVRSSDRYKAQVIE-ALRRAKFK 137

Query: 468 FPGRAKDLRIKEVGFTKYERDEFXKL 545
           FPGR K    K+ GFTKYER+ + +L
Sbjct: 138 FPGRQKIYVSKKWGFTKYERERYEEL 163


>AE014297-4823|AAF57207.1| 1844|Drosophila melanogaster CG1976-PA
           protein.
          Length = 1844

 Score = 29.1 bits (62), Expect = 5.1
 Identities = 12/34 (35%), Positives = 18/34 (52%)
 Frame = +3

Query: 432 GHRGSAPSPSFKFPGRAKDLRIKEVGFTKYERDE 533
           GH+  AP+PS   P   + + I    F KY+ D+
Sbjct: 734 GHQSPAPTPSATLPRPHRQIDINPAEFAKYKLDK 767


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,078,300
Number of Sequences: 53049
Number of extensions: 501708
Number of successful extensions: 1050
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1010
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1040
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2600432100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -