SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B18
         (656 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U75467-1|AAB18341.1|  724|Drosophila melanogaster Atu protein.         37   0.028
AY075403-1|AAL68232.1|  725|Drosophila melanogaster LD30655p pro...    37   0.028
AE014297-303|AAF51991.1|  725|Drosophila melanogaster CG1433-PA ...    37   0.028
AY122082-1|AAM52594.1|  928|Drosophila melanogaster AT26096p pro...    31   1.4  
AE014296-2489|AAF49656.2| 1190|Drosophila melanogaster CG7003-PA...    31   1.8  
BT015206-1|AAT94435.1|  932|Drosophila melanogaster RE62451p pro...    30   2.4  
AF162793-1|AAD50780.1| 1257|Drosophila melanogaster XPG variant ...    30   2.4  
AF162792-1|AAD50779.1| 1236|Drosophila melanogaster XPG protein.       30   2.4  
AF144092-1|AAD38375.1| 1236|Drosophila melanogaster nucleotide e...    30   2.4  
AF125578-1|AAD47568.1| 1236|Drosophila melanogaster DNA repair e...    30   2.4  
AE014134-1515|AAO41169.1| 1236|Drosophila melanogaster CG10890-P...    30   2.4  
AE014134-1514|AAF52678.1| 1236|Drosophila melanogaster CG10890-P...    30   2.4  
AE014134-1513|AAG22424.1| 1257|Drosophila melanogaster CG10890-P...    30   2.4  
Z27119-1|CAA81643.1| 1333|Drosophila melanogaster blastopia poly...    29   4.2  
U97685-1|AAB58311.1|  986|Drosophila melanogaster replication fa...    29   4.2  
L17340-1|AAA28573.1|  986|Drosophila melanogaster transcription ...    29   4.2  
BT003618-1|AAO39621.1|  986|Drosophila melanogaster GH06471p pro...    29   4.2  
AY122077-1|AAM52589.1| 1008|Drosophila melanogaster AT18625p pro...    29   4.2  
AE014297-166|AAF52082.1|  986|Drosophila melanogaster CG1119-PA,...    29   4.2  
AE014297-165|AAX52937.1| 1008|Drosophila melanogaster CG1119-PB,...    29   4.2  
AE014296-326|AAF47543.2| 1062|Drosophila melanogaster CG7971-PA,...    29   4.2  
AE014296-325|AAZ66051.1|  849|Drosophila melanogaster CG7971-PD,...    29   4.2  
AE014296-324|AAF47542.2| 1107|Drosophila melanogaster CG7971-PC,...    29   4.2  
BT015197-1|AAT94426.1|  954|Drosophila melanogaster RE71183p pro...    29   5.6  
AF217651-4|AAF35310.1|  769|Drosophila melanogaster c12.2 protein.     29   5.6  
AE014298-1328|AAN09251.1| 1386|Drosophila melanogaster CG12149-P...    29   5.6  
AE014296-2238|AAF49848.1|  954|Drosophila melanogaster CG11274-P...    29   5.6  
BT016045-1|AAV36930.1|  383|Drosophila melanogaster LP19870p pro...    29   7.3  
AE014297-989|AAF54415.3|  383|Drosophila melanogaster CG8319-PA ...    29   7.3  
BT003619-1|AAO39622.1| 1167|Drosophila melanogaster GH12052p pro...    28   9.7  
AY089552-1|AAL90290.1| 1253|Drosophila melanogaster LD30834p pro...    28   9.7  
AY052127-1|AAK93551.1| 1062|Drosophila melanogaster SD07741p pro...    28   9.7  
AE014297-2213|AAF55319.2| 1298|Drosophila melanogaster CG14896-P...    28   9.7  
AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P...    28   9.7  
AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein.    28   9.7  

>U75467-1|AAB18341.1|  724|Drosophila melanogaster Atu protein.
          Length = 724

 Score = 36.7 bits (81), Expect = 0.028
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 433 KKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSD-DSDVENKA 579
           KK+ R+ + S + KK S  + ++   PTK K+ RL   DSD + DV  KA
Sbjct: 248 KKKARKASGSDQEKKKSGSDSDIEESPTKAKKSRLIDTDSDSNQDVGKKA 297


>AY075403-1|AAL68232.1|  725|Drosophila melanogaster LD30655p
           protein.
          Length = 725

 Score = 36.7 bits (81), Expect = 0.028
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 433 KKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSD-DSDVENKA 579
           KK+ R+ + S + KK S  + ++   PTK K+ RL   DSD + DV  KA
Sbjct: 249 KKKARKASGSDQEKKKSGSDSDIEESPTKAKKSRLIDTDSDSNQDVGKKA 298


>AE014297-303|AAF51991.1|  725|Drosophila melanogaster CG1433-PA
           protein.
          Length = 725

 Score = 36.7 bits (81), Expect = 0.028
 Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
 Frame = +1

Query: 433 KKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSD-DSDVENKA 579
           KK+ R+ + S + KK S  + ++   PTK K+ RL   DSD + DV  KA
Sbjct: 249 KKKARKASGSDQEKKKSGSDSDIEESPTKAKKSRLIDTDSDSNQDVGKKA 298


>AY122082-1|AAM52594.1|  928|Drosophila melanogaster AT26096p
           protein.
          Length = 928

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 19/62 (30%), Positives = 31/62 (50%)
 Frame = +1

Query: 397 RKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENK 576
           R ++   + LE +  +R ITP  +  KA    E     P+K     L   DSD++D+E +
Sbjct: 207 RGTTADWLGLEQEPDQRPITPKAQTAKAQPSSES----PSKNTADILRLPDSDENDMEQE 262

Query: 577 AD 582
           A+
Sbjct: 263 AE 264


>AE014296-2489|AAF49656.2| 1190|Drosophila melanogaster CG7003-PA
           protein.
          Length = 1190

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 5/48 (10%)
 Frame = +3

Query: 276 MSKRNSTGAA----NTLFNYFTKTPP-TNKKLKADATEDTDCNGSPKK 404
           MSK+ +T       NTL NYF+K+P    KKL      D D + S K+
Sbjct: 1   MSKKLNTSVGGTPTNTLLNYFSKSPAFDKKKLTPSVKTDPDASKSEKE 48


>BT015206-1|AAT94435.1|  932|Drosophila melanogaster RE62451p
           protein.
          Length = 932

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 279 SKRNSTGAANTLFNYFTK-TPPTNKKLKADATEDTDCNGSPKKQ 407
           S   S G   T   +F K TP + +K  +DA ED+D   SP K+
Sbjct: 742 SNETSPGTPKTPKPFFRKRTPKSGRKRASDANEDSDEEVSPTKR 785


>AF162793-1|AAD50780.1| 1257|Drosophila melanogaster XPG variant
           protein.
          Length = 1257

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 279 SKRNSTGAANTLFNYFTK-TPPTNKKLKADATEDTDCNGSPKKQ 407
           S   S G   T   +F K TP + +K  +DA ED+D   SP K+
Sbjct: 763 SNETSPGTPKTPKPFFRKRTPKSGRKRASDANEDSDEEVSPTKR 806


>AF162792-1|AAD50779.1| 1236|Drosophila melanogaster XPG protein.
          Length = 1236

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 279 SKRNSTGAANTLFNYFTK-TPPTNKKLKADATEDTDCNGSPKKQ 407
           S   S G   T   +F K TP + +K  +DA ED+D   SP K+
Sbjct: 742 SNETSPGTPKTPKPFFRKRTPKSGRKRASDANEDSDEEVSPTKR 785


>AF144092-1|AAD38375.1| 1236|Drosophila melanogaster nucleotide
           excision repair proteinMUS201 protein.
          Length = 1236

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 279 SKRNSTGAANTLFNYFTK-TPPTNKKLKADATEDTDCNGSPKKQ 407
           S   S G   T   +F K TP + +K  +DA ED+D   SP K+
Sbjct: 742 SNETSPGTPKTPKPFFRKRTPKSGRKRASDANEDSDEEVSPTKR 785


>AF125578-1|AAD47568.1| 1236|Drosophila melanogaster DNA repair
           endonuclease protein.
          Length = 1236

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 279 SKRNSTGAANTLFNYFTK-TPPTNKKLKADATEDTDCNGSPKKQ 407
           S   S G   T   +F K TP + +K  +DA ED+D   SP K+
Sbjct: 742 SNETSPGTPKTPKPFFRKRTPKSGRKRASDANEDSDEEVSPTKR 785


>AE014134-1515|AAO41169.1| 1236|Drosophila melanogaster CG10890-PC,
           isoform C protein.
          Length = 1236

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 279 SKRNSTGAANTLFNYFTK-TPPTNKKLKADATEDTDCNGSPKKQ 407
           S   S G   T   +F K TP + +K  +DA ED+D   SP K+
Sbjct: 742 SNETSPGTPKTPKPFFRKRTPKSGRKRASDANEDSDEEVSPTKR 785


>AE014134-1514|AAF52678.1| 1236|Drosophila melanogaster CG10890-PB,
           isoform B protein.
          Length = 1236

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 279 SKRNSTGAANTLFNYFTK-TPPTNKKLKADATEDTDCNGSPKKQ 407
           S   S G   T   +F K TP + +K  +DA ED+D   SP K+
Sbjct: 742 SNETSPGTPKTPKPFFRKRTPKSGRKRASDANEDSDEEVSPTKR 785


>AE014134-1513|AAG22424.1| 1257|Drosophila melanogaster CG10890-PA,
           isoform A protein.
          Length = 1257

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)
 Frame = +3

Query: 279 SKRNSTGAANTLFNYFTK-TPPTNKKLKADATEDTDCNGSPKKQ 407
           S   S G   T   +F K TP + +K  +DA ED+D   SP K+
Sbjct: 763 SNETSPGTPKTPKPFFRKRTPKSGRKRASDANEDSDEEVSPTKR 806


>Z27119-1|CAA81643.1| 1333|Drosophila melanogaster blastopia
           polyprotein protein.
          Length = 1333

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 11/14 (78%), Positives = 12/14 (85%)
 Frame = +3

Query: 324 FTKTPPTNKKLKAD 365
           FT+TPPTNKKL  D
Sbjct: 2   FTRTPPTNKKLNTD 15


>U97685-1|AAB58311.1|  986|Drosophila melanogaster replication
           factor C large subunit protein.
          Length = 986

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%)
 Frame = +1

Query: 427 ENKKRERQITPS--PELKKA---SSDEEEVISLPTKRKRIRLNPVDSDDSDV 567
           ++ + E   TPS  P+ +KA   SSDE+EV+S P  +KR       S+D  V
Sbjct: 17  KSAEAENGETPSKAPKRRKAVIISSDEDEVVSPPETKKRKASKTASSEDDVV 68


>L17340-1|AAA28573.1|  986|Drosophila melanogaster transcription
           factor protein.
          Length = 986

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%)
 Frame = +1

Query: 427 ENKKRERQITPS--PELKKA---SSDEEEVISLPTKRKRIRLNPVDSDDSDV 567
           ++ + E   TPS  P+ +KA   SSDE+EV+S P  +KR       S+D  V
Sbjct: 17  KSAEAENGETPSKAPKRRKAVIISSDEDEVVSPPETKKRKASKTASSEDDVV 68


>BT003618-1|AAO39621.1|  986|Drosophila melanogaster GH06471p
           protein.
          Length = 986

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%)
 Frame = +1

Query: 427 ENKKRERQITPS--PELKKA---SSDEEEVISLPTKRKRIRLNPVDSDDSDV 567
           ++ + E   TPS  P+ +KA   SSDE+EV+S P  +KR       S+D  V
Sbjct: 17  KSAEAENGETPSKAPKRRKAVIISSDEDEVVSPPETKKRKASKTASSEDDVV 68


>AY122077-1|AAM52589.1| 1008|Drosophila melanogaster AT18625p
           protein.
          Length = 1008

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%)
 Frame = +1

Query: 427 ENKKRERQITPS--PELKKA---SSDEEEVISLPTKRKRIRLNPVDSDDSDV 567
           ++ + E   TPS  P+ +KA   SSDE+EV+S P  +KR       S+D  V
Sbjct: 17  KSAEAENGETPSKAPKRRKAVIISSDEDEVVSPPETKKRKASKTASSEDDVV 68


>AE014297-166|AAF52082.1|  986|Drosophila melanogaster CG1119-PA,
           isoform A protein.
          Length = 986

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%)
 Frame = +1

Query: 427 ENKKRERQITPS--PELKKA---SSDEEEVISLPTKRKRIRLNPVDSDDSDV 567
           ++ + E   TPS  P+ +KA   SSDE+EV+S P  +KR       S+D  V
Sbjct: 17  KSAEAENGETPSKAPKRRKAVIISSDEDEVVSPPETKKRKASKTASSEDDVV 68


>AE014297-165|AAX52937.1| 1008|Drosophila melanogaster CG1119-PB,
           isoform B protein.
          Length = 1008

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 5/52 (9%)
 Frame = +1

Query: 427 ENKKRERQITPS--PELKKA---SSDEEEVISLPTKRKRIRLNPVDSDDSDV 567
           ++ + E   TPS  P+ +KA   SSDE+EV+S P  +KR       S+D  V
Sbjct: 17  KSAEAENGETPSKAPKRRKAVIISSDEDEVVSPPETKKRKASKTASSEDDVV 68


>AE014296-326|AAF47543.2| 1062|Drosophila melanogaster CG7971-PA,
           isoform A protein.
          Length = 1062

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 15/54 (27%), Positives = 25/54 (46%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNK 588
           + KKR R+ + SPE KK    ++      +K+KR R         D +  +D +
Sbjct: 228 KRKKRARESSASPERKKKKKSKKHKKESKSKKKRSRKRKHSESGRDSDRDSDEE 281


>AE014296-325|AAZ66051.1|  849|Drosophila melanogaster CG7971-PD,
           isoform D protein.
          Length = 849

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 15/54 (27%), Positives = 25/54 (46%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNK 588
           + KKR R+ + SPE KK    ++      +K+KR R         D +  +D +
Sbjct: 228 KRKKRARESSASPERKKKKKSKKHKKESKSKKKRSRKRKHSESGRDSDRDSDEE 281


>AE014296-324|AAF47542.2| 1107|Drosophila melanogaster CG7971-PC,
           isoform C protein.
          Length = 1107

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 15/54 (27%), Positives = 25/54 (46%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNK 588
           + KKR R+ + SPE KK    ++      +K+KR R         D +  +D +
Sbjct: 228 KRKKRARESSASPERKKKKKSKKHKKESKSKKKRSRKRKHSESGRDSDRDSDEE 281


>BT015197-1|AAT94426.1|  954|Drosophila melanogaster RE71183p
           protein.
          Length = 954

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 17/53 (32%), Positives = 26/53 (49%)
 Frame = +1

Query: 430 NKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNK 588
           ++KR  + T   E    S  E+E +  P K+++    P DS DSD E  +  K
Sbjct: 813 SRKRGHKKTRRDEAGDNSDSEDEHV--PKKKRKKAKKPADSSDSDSEASSKRK 863


>AF217651-4|AAF35310.1|  769|Drosophila melanogaster c12.2 protein.
          Length = 769

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 15/54 (27%), Positives = 26/54 (48%)
 Frame = +1

Query: 379 PIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLN 540
           P   + +   KK +    KK + Q+ PSP +KK  +  +E   +  K   ++LN
Sbjct: 331 PYQTMLKPDQKKRVEELLKKLDIQLVPSPSIKKIEAQSQENSLIHIKLDELQLN 384


>AE014298-1328|AAN09251.1| 1386|Drosophila melanogaster CG12149-PA
           protein.
          Length = 1386

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 15/54 (27%), Positives = 26/54 (48%)
 Frame = +1

Query: 379 PIVMVPRKSSKKGIHLENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLN 540
           P   + +   KK +    KK + Q+ PSP +KK  +  +E   +  K   ++LN
Sbjct: 331 PYQTMLKPDQKKRVEELLKKLDIQLVPSPSIKKIEAQSQENSLIHIKLDELQLN 384


>AE014296-2238|AAF49848.1|  954|Drosophila melanogaster CG11274-PA
           protein.
          Length = 954

 Score = 29.1 bits (62), Expect = 5.6
 Identities = 17/53 (32%), Positives = 26/53 (49%)
 Frame = +1

Query: 430 NKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNK 588
           ++KR  + T   E    S  E+E +  P K+++    P DS DSD E  +  K
Sbjct: 813 SRKRGHKKTRRDEAGDNSDSEDEHV--PKKKRKKAKKPADSSDSDSEASSKRK 863


>BT016045-1|AAV36930.1|  383|Drosophila melanogaster LP19870p
           protein.
          Length = 383

 Score = 28.7 bits (61), Expect = 7.3
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = +2

Query: 401 KAVKKEYILKTKNAKGKLHPHRSLRRLRVMKKKLFHCQLREKE 529
           K +KK +   ++  K  +   R+ R+LR +K + F C+L  K+
Sbjct: 117 KEIKKTHQTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQ 159


>AE014297-989|AAF54415.3|  383|Drosophila melanogaster CG8319-PA
           protein.
          Length = 383

 Score = 28.7 bits (61), Expect = 7.3
 Identities = 13/43 (30%), Positives = 24/43 (55%)
 Frame = +2

Query: 401 KAVKKEYILKTKNAKGKLHPHRSLRRLRVMKKKLFHCQLREKE 529
           K +KK +   ++  K  +   R+ R+LR +K + F C+L  K+
Sbjct: 117 KEIKKTHQTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQ 159


>BT003619-1|AAO39622.1| 1167|Drosophila melanogaster GH12052p
           protein.
          Length = 1167

 Score = 28.3 bits (60), Expect = 9.7
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = +2

Query: 332 NTANE*KIKSGRY*RYRL*WFPEKAVKKEYILKTKNAKGKLHPHRSLRRLR 484
           N+ N    +SG+Y R    W P + +++  ++    A     PH +LR+ R
Sbjct: 554 NSTNRMDQESGKYQRVYADWKPSRTLEQTDVVANLQAIADAQPHDALRQHR 604


>AY089552-1|AAL90290.1| 1253|Drosophila melanogaster LD30834p
           protein.
          Length = 1253

 Score = 28.3 bits (60), Expect = 9.7
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +1

Query: 457 PSPEL-KKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNKIGT 597
           P PE+ K+  S+ E+VI +   +KR+R       D+ ++NK   KI T
Sbjct: 340 PEPEVEKRIESNAEQVIIIDKPKKRLRKASSKESDTLLDNK--EKINT 385


>AY052127-1|AAK93551.1| 1062|Drosophila melanogaster SD07741p
           protein.
          Length = 1062

 Score = 28.3 bits (60), Expect = 9.7
 Identities = 14/54 (25%), Positives = 25/54 (46%)
 Frame = +1

Query: 427 ENKKRERQITPSPELKKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNK 588
           + KKR R+ + SPE KK    ++      +K+K+ R         D +  +D +
Sbjct: 228 KRKKRARESSASPERKKKKKSKKHKKESKSKKKKSRKRKHSESGRDSDRDSDEE 281


>AE014297-2213|AAF55319.2| 1298|Drosophila melanogaster CG14896-PA
           protein.
          Length = 1298

 Score = 28.3 bits (60), Expect = 9.7
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 1/48 (2%)
 Frame = +1

Query: 457 PSPEL-KKASSDEEEVISLPTKRKRIRLNPVDSDDSDVENKADNKIGT 597
           P PE+ K+  S+ E+VI +   +KR+R       D+ ++NK   KI T
Sbjct: 385 PEPEVEKRIESNAEQVIIIDKPKKRLRKASSKESDTLLDNK--EKINT 430


>AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA
            protein.
          Length = 1644

 Score = 28.3 bits (60), Expect = 9.7
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = +2

Query: 332  NTANE*KIKSGRY*RYRL*WFPEKAVKKEYILKTKNAKGKLHPHRSLRRLR 484
            N+ N    +SG+Y R    W P + +++  ++    A     PH +LR+ R
Sbjct: 1031 NSTNRMDQESGKYQRVYADWKPSRTLEQTDVVANLQAIADAQPHDALRQHR 1081


>AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein.
          Length = 1644

 Score = 28.3 bits (60), Expect = 9.7
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = +2

Query: 332  NTANE*KIKSGRY*RYRL*WFPEKAVKKEYILKTKNAKGKLHPHRSLRRLR 484
            N+ N    +SG+Y R    W P + +++  ++    A     PH +LR+ R
Sbjct: 1031 NSTNRMDQESGKYQRVYADWKPSRTLEQTDVVANLQAIADAQPHDALRQHR 1081


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,501,441
Number of Sequences: 53049
Number of extensions: 413126
Number of successful extensions: 1740
Number of sequences better than 10.0: 35
Number of HSP's better than 10.0 without gapping: 1623
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1732
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2806815600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -