SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B17
         (629 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY102666-1|AAM27495.1|   96|Drosophila melanogaster GM01344p pro...   142   4e-34
AE014297-792|AAF54272.1|   96|Drosophila melanogaster CG9790-PA ...   142   4e-34
U40077-1|AAB02189.1|   74|Drosophila melanogaster DmCks1 protein.     122   3e-28
AY061285-1|AAL28833.1|   74|Drosophila melanogaster LD20271p pro...   122   3e-28
AE014134-1622|AAF52763.1|   74|Drosophila melanogaster CG3738-PA...   122   3e-28
AY121651-1|AAM51978.1|  866|Drosophila melanogaster LD47926p pro...    29   3.9  
AY032609-1|AAK39641.1|  866|Drosophila melanogaster Zn finger tr...    29   3.9  
AJ311850-1|CAC51080.1|  806|Drosophila melanogaster zinc finger ...    29   3.9  
AE014297-3254|AAF56082.2|  692|Drosophila melanogaster CG4677-PA...    29   3.9  
AE014297-3253|AAN13923.1|  866|Drosophila melanogaster CG4677-PB...    29   3.9  

>AY102666-1|AAM27495.1|   96|Drosophila melanogaster GM01344p
           protein.
          Length = 96

 Score =  142 bits (344), Expect = 4e-34
 Identities = 62/78 (79%), Positives = 70/78 (89%)
 Frame = +2

Query: 110 MPVDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVH 289
           MP DQIQYSE+Y DD +EYRHVILPPD+A+ VPK+HLMTETEWRNLGVQQSPGW+H+MVH
Sbjct: 1   MPADQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVH 60

Query: 290 NPEPHVLLFRRPRTDIPA 343
            PEPHV+LFRR R  IPA
Sbjct: 61  APEPHVILFRRKR--IPA 76


>AE014297-792|AAF54272.1|   96|Drosophila melanogaster CG9790-PA
           protein.
          Length = 96

 Score =  142 bits (344), Expect = 4e-34
 Identities = 62/78 (79%), Positives = 70/78 (89%)
 Frame = +2

Query: 110 MPVDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVH 289
           MP DQIQYSE+Y DD +EYRHVILPPD+A+ VPK+HLMTETEWRNLGVQQSPGW+H+MVH
Sbjct: 1   MPADQIQYSEKYFDDNFEYRHVILPPDLAKHVPKAHLMTETEWRNLGVQQSPGWVHYMVH 60

Query: 290 NPEPHVLLFRRPRTDIPA 343
            PEPHV+LFRR R  IPA
Sbjct: 61  APEPHVILFRRKR--IPA 76


>U40077-1|AAB02189.1|   74|Drosophila melanogaster DmCks1 protein.
          Length = 74

 Score =  122 bits (295), Expect = 3e-28
 Identities = 46/70 (65%), Positives = 62/70 (88%)
 Frame = +2

Query: 125 IQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEPH 304
           I YS++Y D+ +EYRHV+LP ++ +MVPK+HLMTE EWR++GVQQS GW+H+M+H PEPH
Sbjct: 5   IYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPH 64

Query: 305 VLLFRRPRTD 334
           +LLFRRP+TD
Sbjct: 65  ILLFRRPKTD 74


>AY061285-1|AAL28833.1|   74|Drosophila melanogaster LD20271p
           protein.
          Length = 74

 Score =  122 bits (295), Expect = 3e-28
 Identities = 46/70 (65%), Positives = 62/70 (88%)
 Frame = +2

Query: 125 IQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEPH 304
           I YS++Y D+ +EYRHV+LP ++ +MVPK+HLMTE EWR++GVQQS GW+H+M+H PEPH
Sbjct: 5   IYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPH 64

Query: 305 VLLFRRPRTD 334
           +LLFRRP+TD
Sbjct: 65  ILLFRRPKTD 74


>AE014134-1622|AAF52763.1|   74|Drosophila melanogaster CG3738-PA
           protein.
          Length = 74

 Score =  122 bits (295), Expect = 3e-28
 Identities = 46/70 (65%), Positives = 62/70 (88%)
 Frame = +2

Query: 125 IQYSERYTDDVYEYRHVILPPDIARMVPKSHLMTETEWRNLGVQQSPGWLHFMVHNPEPH 304
           I YS++Y D+ +EYRHV+LP ++ +MVPK+HLMTE EWR++GVQQS GW+H+M+H PEPH
Sbjct: 5   IYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQSRGWIHYMIHKPEPH 64

Query: 305 VLLFRRPRTD 334
           +LLFRRP+TD
Sbjct: 65  ILLFRRPKTD 74


>AY121651-1|AAM51978.1|  866|Drosophila melanogaster LD47926p
           protein.
          Length = 866

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +2

Query: 80  ILFDAIKTTVMPVDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHL 220
           I+  A + T MP  Q QY++   +D++ +     P DIAR+  +S L
Sbjct: 114 IVCAAAENTGMPYQQGQYTQLNREDIFRFE----PEDIARLTGESEL 156


>AY032609-1|AAK39641.1|  866|Drosophila melanogaster Zn finger
           transcription factorlame duck protein.
          Length = 866

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +2

Query: 80  ILFDAIKTTVMPVDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHL 220
           I+  A + T MP  Q QY++   +D++ +     P DIAR+  +S L
Sbjct: 114 IVCAAAENTGMPYQQGQYTQLNREDIFRFE----PEDIARLTGESEL 156


>AJ311850-1|CAC51080.1|  806|Drosophila melanogaster zinc finger
           transcription factor protein.
          Length = 806

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +2

Query: 80  ILFDAIKTTVMPVDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHL 220
           I+  A + T MP  Q QY++   +D++ +     P DIAR+  +S L
Sbjct: 114 IVCAAAENTGMPYQQGQYTQLNREDIFRFE----PEDIARLTGESEL 156


>AE014297-3254|AAF56082.2|  692|Drosophila melanogaster CG4677-PA,
           isoform A protein.
          Length = 692

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +2

Query: 80  ILFDAIKTTVMPVDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHL 220
           I+  A + T MP  Q QY++   +D++ +     P DIAR+  +S L
Sbjct: 114 IVCAAAENTGMPYQQGQYTQLNREDIFRFE----PEDIARLTGESEL 156


>AE014297-3253|AAN13923.1|  866|Drosophila melanogaster CG4677-PB,
           isoform B protein.
          Length = 866

 Score = 29.5 bits (63), Expect = 3.9
 Identities = 16/47 (34%), Positives = 26/47 (55%)
 Frame = +2

Query: 80  ILFDAIKTTVMPVDQIQYSERYTDDVYEYRHVILPPDIARMVPKSHL 220
           I+  A + T MP  Q QY++   +D++ +     P DIAR+  +S L
Sbjct: 114 IVCAAAENTGMPYQQGQYTQLNREDIFRFE----PEDIARLTGESEL 156


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,543,018
Number of Sequences: 53049
Number of extensions: 533727
Number of successful extensions: 1100
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1068
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1100
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2621070450
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -