SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B16
         (656 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT003439-1|AAO39442.1|  366|Drosophila melanogaster RH73632p pro...    32   0.79 
BT001432-1|AAN71187.1|  367|Drosophila melanogaster GH19412p pro...    32   0.79 
AY071085-1|AAL48707.1|  366|Drosophila melanogaster RE15265p pro...    32   0.79 
AE014296-2124|AAF49935.1|  367|Drosophila melanogaster CG4300-PA...    32   0.79 
AE014296-2123|AAF49934.1|  366|Drosophila melanogaster CG4300-PB...    32   0.79 
AY060724-1|AAL28272.1|  694|Drosophila melanogaster GH17145p pro...    29   4.2  
AE014296-2824|AAF49397.2|  694|Drosophila melanogaster CG11915-P...    29   4.2  

>BT003439-1|AAO39442.1|  366|Drosophila melanogaster RH73632p
           protein.
          Length = 366

 Score = 31.9 bits (69), Expect = 0.79
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +1

Query: 103 RNPAVKIAIVQSKTGGNCLLIDYLLS-RNSPLV*NKSFTCR 222
           R+P  KI I+ SKT GN LL+D L +   S L+  ++  CR
Sbjct: 148 RSPFQKIQIMHSKTLGNMLLLDELQNIAESDLIYTETLMCR 188


>BT001432-1|AAN71187.1|  367|Drosophila melanogaster GH19412p
           protein.
          Length = 367

 Score = 31.9 bits (69), Expect = 0.79
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +1

Query: 103 RNPAVKIAIVQSKTGGNCLLIDYLLS-RNSPLV*NKSFTCR 222
           R+P  KI I+ SKT GN LL+D L +   S L+  ++  CR
Sbjct: 149 RSPFQKIQIMHSKTLGNMLLLDELQNIAESDLIYTETLMCR 189


>AY071085-1|AAL48707.1|  366|Drosophila melanogaster RE15265p
           protein.
          Length = 366

 Score = 31.9 bits (69), Expect = 0.79
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +1

Query: 103 RNPAVKIAIVQSKTGGNCLLIDYLLS-RNSPLV*NKSFTCR 222
           R+P  KI I+ SKT GN LL+D L +   S L+  ++  CR
Sbjct: 148 RSPFQKIQIMHSKTLGNMLLLDELQNIAESDLIYTETLMCR 188


>AE014296-2124|AAF49935.1|  367|Drosophila melanogaster CG4300-PA,
           isoform A protein.
          Length = 367

 Score = 31.9 bits (69), Expect = 0.79
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +1

Query: 103 RNPAVKIAIVQSKTGGNCLLIDYLLS-RNSPLV*NKSFTCR 222
           R+P  KI I+ SKT GN LL+D L +   S L+  ++  CR
Sbjct: 149 RSPFQKIQIMHSKTLGNMLLLDELQNIAESDLIYTETLMCR 189


>AE014296-2123|AAF49934.1|  366|Drosophila melanogaster CG4300-PB,
           isoform B protein.
          Length = 366

 Score = 31.9 bits (69), Expect = 0.79
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)
 Frame = +1

Query: 103 RNPAVKIAIVQSKTGGNCLLIDYLLS-RNSPLV*NKSFTCR 222
           R+P  KI I+ SKT GN LL+D L +   S L+  ++  CR
Sbjct: 148 RSPFQKIQIMHSKTLGNMLLLDELQNIAESDLIYTETLMCR 188


>AY060724-1|AAL28272.1|  694|Drosophila melanogaster GH17145p
           protein.
          Length = 694

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 1/76 (1%)
 Frame = +3

Query: 117 ENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDLVERLLEQ 296
           E   S EQ R+ + + R    E+    L+++   + R   A    RKQ   +  ERL  +
Sbjct: 140 EKEESEEQQRKLVEAERQREREQAEKELQEQREAERRQLEAEENQRKQRENEEKERLENE 199

Query: 297 RALV-AEAVRRLKEKK 341
           R L+ AE  R   E++
Sbjct: 200 RRLIDAEREREENERR 215


>AE014296-2824|AAF49397.2|  694|Drosophila melanogaster CG11915-PA
           protein.
          Length = 694

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 1/76 (1%)
 Frame = +3

Query: 117 ENRHSTEQDRRQLPSNRLPPIEELTLGLKQKLHLQARARAAPYYIRKQEPVDLVERLLEQ 296
           E   S EQ R+ + + R    E+    L+++   + R   A    RKQ   +  ERL  +
Sbjct: 140 EKEESEEQQRKLVEAERQREREQAEKELQEQREAERRQLEAEENQRKQRENEEKERLENE 199

Query: 297 RALV-AEAVRRLKEKK 341
           R L+ AE  R   E++
Sbjct: 200 RRLIDAEREREENERR 215


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,851,793
Number of Sequences: 53049
Number of extensions: 552484
Number of successful extensions: 1387
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1343
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1387
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2806815600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -