SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B15
         (511 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y11119-1|CAA72004.1|  120|Drosophila melanogaster S20 ribosomal ...   108   5e-24
AY071742-1|AAL49364.1|  120|Drosophila melanogaster RH47995p pro...   108   5e-24
AE014297-2870|AAF55809.1|  120|Drosophila melanogaster CG15693-P...   108   5e-24
AY071353-1|AAL48975.1|  120|Drosophila melanogaster RE38972p pro...   103   1e-22

>Y11119-1|CAA72004.1|  120|Drosophila melanogaster S20 ribosomal
           protein protein.
          Length = 120

 Score =  108 bits (259), Expect = 5e-24
 Identities = 53/66 (80%), Positives = 56/66 (84%), Gaps = 1/66 (1%)
 Frame = +1

Query: 133 KDIEKPQA-EVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 309
           KDIEKP   + + +HRIRITLTSRNVRSLE VC DLINGAK Q LRVKGPVRMPTK LRI
Sbjct: 6   KDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRI 65

Query: 310 TTRKTP 327
           TTRKTP
Sbjct: 66  TTRKTP 71



 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 45/48 (93%), Positives = 48/48 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           GEGSKTWDRFQMRIHKR+IDLHSPSEIVK+ITSINIEPGVEVEVTIA+
Sbjct: 73  GEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120


>AY071742-1|AAL49364.1|  120|Drosophila melanogaster RH47995p
           protein.
          Length = 120

 Score =  108 bits (259), Expect = 5e-24
 Identities = 53/66 (80%), Positives = 56/66 (84%), Gaps = 1/66 (1%)
 Frame = +1

Query: 133 KDIEKPQA-EVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 309
           KDIEKP   + + +HRIRITLTSRNVRSLE VC DLINGAK Q LRVKGPVRMPTK LRI
Sbjct: 6   KDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRI 65

Query: 310 TTRKTP 327
           TTRKTP
Sbjct: 66  TTRKTP 71



 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 45/48 (93%), Positives = 48/48 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           GEGSKTWDRFQMRIHKR+IDLHSPSEIVK+ITSINIEPGVEVEVTIA+
Sbjct: 73  GEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120


>AE014297-2870|AAF55809.1|  120|Drosophila melanogaster CG15693-PA
           protein.
          Length = 120

 Score =  108 bits (259), Expect = 5e-24
 Identities = 53/66 (80%), Positives = 56/66 (84%), Gaps = 1/66 (1%)
 Frame = +1

Query: 133 KDIEKPQA-EVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 309
           KDIEKP   + + +HRIRITLTSRNVRSLE VC DLINGAK Q LRVKGPVRMPTK LRI
Sbjct: 6   KDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNLRVKGPVRMPTKTLRI 65

Query: 310 TTRKTP 327
           TTRKTP
Sbjct: 66  TTRKTP 71



 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 45/48 (93%), Positives = 48/48 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           GEGSKTWDRFQMRIHKR+IDLHSPSEIVK+ITSINIEPGVEVEVTIA+
Sbjct: 73  GEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120


>AY071353-1|AAL48975.1|  120|Drosophila melanogaster RE38972p
           protein.
          Length = 120

 Score =  103 bits (247), Expect = 1e-22
 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 1/66 (1%)
 Frame = +1

Query: 133 KDIEKPQA-EVSPIHRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMPTKILRI 309
           KDIEKP   + + +H IRITLTSRNVRSLE VC DLINGAK Q LRV+GPVRMPTK LRI
Sbjct: 6   KDIEKPHVGDSASVHCIRITLTSRNVRSLENVCRDLINGAKNQNLRVEGPVRMPTKTLRI 65

Query: 310 TTRKTP 327
           TTRKTP
Sbjct: 66  TTRKTP 71



 Score = 99.1 bits (236), Expect = 3e-21
 Identities = 45/48 (93%), Positives = 48/48 (100%)
 Frame = +2

Query: 332 GEGSKTWDRFQMRIHKRVIDLHSPSEIVKQITSINIEPGVEVEVTIAD 475
           GEGSKTWDRFQMRIHKR+IDLHSPSEIVK+ITSINIEPGVEVEVTIA+
Sbjct: 73  GEGSKTWDRFQMRIHKRIIDLHSPSEIVKKITSINIEPGVEVEVTIAN 120


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,084,734
Number of Sequences: 53049
Number of extensions: 541105
Number of successful extensions: 1436
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1343
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1435
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1846255872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -