SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B14
         (558 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY070896-1|AAL48518.1|  160|Drosophila melanogaster LP04958p pro...   236   2e-62
AE014298-2882|AAN09507.1|  160|Drosophila melanogaster CG14206-P...   236   2e-62
AE014298-2881|AAF48978.2|  160|Drosophila melanogaster CG14206-P...   236   2e-62
AE014297-4155|AAF56731.1|  163|Drosophila melanogaster CG12275-P...   205   4e-53
AF145693-1|AAD38668.2|  162|Drosophila melanogaster LD32148p pro...   203   1e-52
BT003619-1|AAO39622.1| 1167|Drosophila melanogaster GH12052p pro...    29   5.6  
AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P...    29   5.6  
AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein.    29   5.6  
BT021440-1|AAX33588.1| 1214|Drosophila melanogaster GH07101p pro...    28   7.4  
BT012663-1|AAT08469.1| 1057|Drosophila melanogaster RE66582p pro...    28   7.4  
BT009939-1|AAQ22408.1| 1108|Drosophila melanogaster SD05496p pro...    28   7.4  
AY069524-1|AAL39669.1|  948|Drosophila melanogaster LD23883p pro...    28   7.4  
AY061436-1|AAL28984.1|  542|Drosophila melanogaster LD36410p pro...    28   7.4  
AE014296-1456|AAF50415.2| 1039|Drosophila melanogaster CG7015-PA...    28   7.4  
AE013599-2009|AAS64853.1| 1108|Drosophila melanogaster CG11798-P...    28   7.4  
AE013599-2008|AAF58171.1| 1108|Drosophila melanogaster CG11798-P...    28   7.4  
AE013599-2007|ABI31096.1| 1214|Drosophila melanogaster CG11798-P...    28   7.4  
AY113398-1|AAM29403.1|  915|Drosophila melanogaster RE09008p pro...    28   9.8  
AY069546-1|AAL39691.1|  429|Drosophila melanogaster LD27370p pro...    28   9.8  
AE014296-2473|AAF49667.2|  429|Drosophila melanogaster CG6854-PA...    28   9.8  
AE013599-3371|AAM68218.1|  915|Drosophila melanogaster CG5819-PB...    28   9.8  
AE013599-3370|AAF46828.1|  915|Drosophila melanogaster CG5819-PA...    28   9.8  

>AY070896-1|AAL48518.1|  160|Drosophila melanogaster LP04958p
           protein.
          Length = 160

 Score =  236 bits (577), Expect = 2e-62
 Identities = 114/160 (71%), Positives = 129/160 (80%), Gaps = 4/160 (2%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M MPK +RVAIYEYLFKEGV+VAKKD+HA KH ELE IPNL VIKAMQSL SRG VKEQF
Sbjct: 1   MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPELESIPNLHVIKAMQSLHSRGLVKEQF 60

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGP-VGRPDAP---ARSA 403
           AWRH+YWYLTNEGIE LR +LHLPPEIVP+TLKR  R+ETVR  P VG P  P   +++ 
Sbjct: 61  AWRHYYWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRPRPAVGGPRGPGDASKTG 120

Query: 404 EDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRG 523
           EDRSAYRR P   GV   DKK DVGPG+ ++EF+GG+GRG
Sbjct: 121 EDRSAYRRAPGGSGV---DKKGDVGPGAGEVEFRGGFGRG 157


>AE014298-2882|AAN09507.1|  160|Drosophila melanogaster CG14206-PC,
           isoform C protein.
          Length = 160

 Score =  236 bits (577), Expect = 2e-62
 Identities = 114/160 (71%), Positives = 129/160 (80%), Gaps = 4/160 (2%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M MPK +RVAIYEYLFKEGV+VAKKD+HA KH ELE IPNL VIKAMQSL SRG VKEQF
Sbjct: 1   MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPELESIPNLHVIKAMQSLHSRGLVKEQF 60

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGP-VGRPDAP---ARSA 403
           AWRH+YWYLTNEGIE LR +LHLPPEIVP+TLKR  R+ETVR  P VG P  P   +++ 
Sbjct: 61  AWRHYYWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRPRPAVGGPRGPGDASKTG 120

Query: 404 EDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRG 523
           EDRSAYRR P   GV   DKK DVGPG+ ++EF+GG+GRG
Sbjct: 121 EDRSAYRRAPGGSGV---DKKGDVGPGAGEVEFRGGFGRG 157


>AE014298-2881|AAF48978.2|  160|Drosophila melanogaster CG14206-PB,
           isoform B protein.
          Length = 160

 Score =  236 bits (577), Expect = 2e-62
 Identities = 114/160 (71%), Positives = 129/160 (80%), Gaps = 4/160 (2%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M MPK +RVAIYEYLFKEGV+VAKKD+HA KH ELE IPNL VIKAMQSL SRG VKEQF
Sbjct: 1   MFMPKAHRVAIYEYLFKEGVIVAKKDFHAQKHPELESIPNLHVIKAMQSLHSRGLVKEQF 60

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGP-VGRPDAP---ARSA 403
           AWRH+YWYLTNEGIE LR +LHLPPEIVP+TLKR  R+ETVR  P VG P  P   +++ 
Sbjct: 61  AWRHYYWYLTNEGIEELRSYLHLPPEIVPSTLKRPARSETVRPRPAVGGPRGPGDASKTG 120

Query: 404 EDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGRG 523
           EDRSAYRR P   GV   DKK DVGPG+ ++EF+GG+GRG
Sbjct: 121 EDRSAYRRAPGGSGV---DKKGDVGPGAGEVEFRGGFGRG 157


>AE014297-4155|AAF56731.1|  163|Drosophila melanogaster CG12275-PA
           protein.
          Length = 163

 Score =  205 bits (500), Expect = 4e-53
 Identities = 102/160 (63%), Positives = 122/160 (76%), Gaps = 5/160 (3%)
 Frame = +2

Query: 56  MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 235
           M +PK NRVAIYEYLFKEGV+VAKKD    KH+EL+KIPNLQVIK MQSL SRG+VKEQF
Sbjct: 1   MFIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSELDKIPNLQVIKVMQSLNSRGWVKEQF 60

Query: 236 AWRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVR-RGPVGRP----DAPARS 400
           AWRHFYW LTNEGIE LR +LHLPPEIVP+TL ++ R+  VR RG  G P       +++
Sbjct: 61  AWRHFYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAVRPRGGPGGPGGGFGGASKT 120

Query: 401 AEDRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGR 520
            +DRS YRR P A G+   DKK DVG G+  +E++GG+GR
Sbjct: 121 DDDRSNYRRGPGAYGM---DKKGDVGAGTGRVEYRGGFGR 157


>AF145693-1|AAD38668.2|  162|Drosophila melanogaster LD32148p
           protein.
          Length = 162

 Score =  203 bits (495), Expect = 1e-52
 Identities = 101/158 (63%), Positives = 121/158 (76%), Gaps = 5/158 (3%)
 Frame = +2

Query: 62  MPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQFAW 241
           +PK NRVAIYEYLFKEGV+VAKKD    KH+EL+KIPNLQVIK MQSL SRG+VKEQFAW
Sbjct: 2   IPKANRVAIYEYLFKEGVLVAKKDSPIQKHSELDKIPNLQVIKVMQSLNSRGWVKEQFAW 61

Query: 242 RHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVR-RGPVGRP----DAPARSAE 406
           RHFYW LTNEGIE LR +LHLPPEIVP+TL ++ R+  VR RG  G P       +++ +
Sbjct: 62  RHFYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAVRPRGGPGGPGGGFGGASKTDD 121

Query: 407 DRSAYRRTPAAPGVAPHDKKADVGPGSADLEFKGGYGR 520
           DRS YRR P A G+   DKK DVG G+  +E++GG+GR
Sbjct: 122 DRSNYRRGPGAYGM---DKKGDVGAGTGRVEYRGGFGR 156


>BT003619-1|AAO39622.1| 1167|Drosophila melanogaster GH12052p protein.
          Length = 1167

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = +2

Query: 308  PEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTP 433
            P    AT+KRS+      R P G+P A A      S  RR+P
Sbjct: 947  PATQTATVKRSLSASRPLRMPNGQPLASAAPLRSASTVRRSP 988


>AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA
            protein.
          Length = 1644

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = +2

Query: 308  PEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTP 433
            P    AT+KRS+      R P G+P A A      S  RR+P
Sbjct: 1424 PATQTATVKRSLSASRPLRMPNGQPLASAAPLRSASTVRRSP 1465


>AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein.
          Length = 1644

 Score = 28.7 bits (61), Expect = 5.6
 Identities = 16/42 (38%), Positives = 20/42 (47%)
 Frame = +2

Query: 308  PEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDRSAYRRTP 433
            P    AT+KRS+      R P G+P A A      S  RR+P
Sbjct: 1424 PATQTATVKRSLSASRPLRMPNGQPLASAAPLRSASTVRRSP 1465


>BT021440-1|AAX33588.1| 1214|Drosophila melanogaster GH07101p protein.
          Length = 1214

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 9/65 (13%)
 Frame = +2

Query: 263  TNEGIEYLR----IFLHLPPEIVP-----ATLKRSVRTETVRRGPVGRPDAPARSAEDRS 415
            T E IEYLR    I L + P++ P     + LKR +   T RR P  +  APA S    +
Sbjct: 1025 TEEYIEYLRNKEDITLTIAPKVQPPAPVTSLLKRQLDLSTPRRSP--KKAAPAHSNSASN 1082

Query: 416  AYRRT 430
            A R++
Sbjct: 1083 ASRKS 1087


>BT012663-1|AAT08469.1| 1057|Drosophila melanogaster RE66582p
           protein.
          Length = 1057

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = -2

Query: 521 HVHSLP*IQDQLSLDQHQPFYHEVQHQGQQEY 426
           H H    +Q Q    QHQ  + + QHQ QQ++
Sbjct: 85  HQHQQQHMQQQQQQQQHQQQHQQQQHQQQQQH 116


>BT009939-1|AAQ22408.1| 1108|Drosophila melanogaster SD05496p protein.
          Length = 1108

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 9/65 (13%)
 Frame = +2

Query: 263  TNEGIEYLR----IFLHLPPEIVP-----ATLKRSVRTETVRRGPVGRPDAPARSAEDRS 415
            T E IEYLR    I L + P++ P     + LKR +   T RR P  +  APA S    +
Sbjct: 919  TEEYIEYLRNKEDITLTIAPKVQPPAPVTSLLKRQLDLSTPRRSP--KKAAPAHSNSASN 976

Query: 416  AYRRT 430
            A R++
Sbjct: 977  ASRKS 981


>AY069524-1|AAL39669.1|  948|Drosophila melanogaster LD23883p
           protein.
          Length = 948

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 9/65 (13%)
 Frame = +2

Query: 263 TNEGIEYLR----IFLHLPPEIVP-----ATLKRSVRTETVRRGPVGRPDAPARSAEDRS 415
           T E IEYLR    I L + P++ P     + LKR +   T RR P  +  APA S    +
Sbjct: 759 TEEYIEYLRNKEDITLTIAPKVQPPAPVTSLLKRQLDLSTPRRSP--KKAAPAHSNSASN 816

Query: 416 AYRRT 430
           A R++
Sbjct: 817 ASRKS 821


>AY061436-1|AAL28984.1|  542|Drosophila melanogaster LD36410p
           protein.
          Length = 542

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 9/65 (13%)
 Frame = +2

Query: 263 TNEGIEYLR----IFLHLPPEIVP-----ATLKRSVRTETVRRGPVGRPDAPARSAEDRS 415
           T E IEYLR    I L + P++ P     + LKR +   T RR P  +  APA S    +
Sbjct: 353 TEEYIEYLRNKEDITLTIAPKVQPPAPVTSLLKRQLDLSTPRRSP--KKAAPAHSNSASN 410

Query: 416 AYRRT 430
           A R++
Sbjct: 411 ASRKS 415


>AE014296-1456|AAF50415.2| 1039|Drosophila melanogaster CG7015-PA
           protein.
          Length = 1039

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 12/32 (37%), Positives = 17/32 (53%)
 Frame = -2

Query: 521 HVHSLP*IQDQLSLDQHQPFYHEVQHQGQQEY 426
           H H    +Q Q    QHQ  + + QHQ QQ++
Sbjct: 85  HQHQQQHMQQQQQQQQHQQQHQQQQHQQQQQH 116


>AE013599-2009|AAS64853.1| 1108|Drosophila melanogaster CG11798-PB,
            isoform B protein.
          Length = 1108

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 9/65 (13%)
 Frame = +2

Query: 263  TNEGIEYLR----IFLHLPPEIVP-----ATLKRSVRTETVRRGPVGRPDAPARSAEDRS 415
            T E IEYLR    I L + P++ P     + LKR +   T RR P  +  APA S    +
Sbjct: 919  TEEYIEYLRNKEDITLTIAPKVQPPAPVTSLLKRQLDLSTPRRSP--KKAAPAHSNSASN 976

Query: 416  AYRRT 430
            A R++
Sbjct: 977  ASRKS 981


>AE013599-2008|AAF58171.1| 1108|Drosophila melanogaster CG11798-PA,
            isoform A protein.
          Length = 1108

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 9/65 (13%)
 Frame = +2

Query: 263  TNEGIEYLR----IFLHLPPEIVP-----ATLKRSVRTETVRRGPVGRPDAPARSAEDRS 415
            T E IEYLR    I L + P++ P     + LKR +   T RR P  +  APA S    +
Sbjct: 919  TEEYIEYLRNKEDITLTIAPKVQPPAPVTSLLKRQLDLSTPRRSP--KKAAPAHSNSASN 976

Query: 416  AYRRT 430
            A R++
Sbjct: 977  ASRKS 981


>AE013599-2007|ABI31096.1| 1214|Drosophila melanogaster CG11798-PC,
            isoform C protein.
          Length = 1214

 Score = 28.3 bits (60), Expect = 7.4
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 9/65 (13%)
 Frame = +2

Query: 263  TNEGIEYLR----IFLHLPPEIVP-----ATLKRSVRTETVRRGPVGRPDAPARSAEDRS 415
            T E IEYLR    I L + P++ P     + LKR +   T RR P  +  APA S    +
Sbjct: 1025 TEEYIEYLRNKEDITLTIAPKVQPPAPVTSLLKRQLDLSTPRRSP--KKAAPAHSNSASN 1082

Query: 416  AYRRT 430
            A R++
Sbjct: 1083 ASRKS 1087


>AY113398-1|AAM29403.1|  915|Drosophila melanogaster RE09008p
           protein.
          Length = 915

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 305 PPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDR-SAYRRTPAAPGVAPHDKKAD 472
           PP + P T+K S +  T+++ PV   D PA   ED  SA R+ P++  +A   ++ D
Sbjct: 789 PPVLPPPTMKVSAQVYTLQQSPVLELD-PA--IEDYFSAARKQPSSSTIASDFQELD 842


>AY069546-1|AAL39691.1|  429|Drosophila melanogaster LD27370p
           protein.
          Length = 429

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -1

Query: 444 PGAAGVRLYADLSSAERAGASGRPTGPRRTVS 349
           PG+A V   A  +SA    ++G P G +R+VS
Sbjct: 269 PGSAAVLAPATTTSASSVSSNGAPMGGKRSVS 300


>AE014296-2473|AAF49667.2|  429|Drosophila melanogaster CG6854-PA,
           isoform A protein.
          Length = 429

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = -1

Query: 444 PGAAGVRLYADLSSAERAGASGRPTGPRRTVS 349
           PG+A V   A  +SA    ++G P G +R+VS
Sbjct: 269 PGSAAVLAPATTTSASSVSSNGAPMGGKRSVS 300


>AE013599-3371|AAM68218.1|  915|Drosophila melanogaster CG5819-PB,
           isoform B protein.
          Length = 915

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 305 PPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDR-SAYRRTPAAPGVAPHDKKAD 472
           PP + P T+K S +  T+++ PV   D PA   ED  SA R+ P++  +A   ++ D
Sbjct: 789 PPVLPPPTMKVSAQVYTLQQSPVLELD-PA--IEDYFSAARKQPSSSTIASDFQELD 842


>AE013599-3370|AAF46828.1|  915|Drosophila melanogaster CG5819-PA,
           isoform A protein.
          Length = 915

 Score = 27.9 bits (59), Expect = 9.8
 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 305 PPEIVPATLKRSVRTETVRRGPVGRPDAPARSAEDR-SAYRRTPAAPGVAPHDKKAD 472
           PP + P T+K S +  T+++ PV   D PA   ED  SA R+ P++  +A   ++ D
Sbjct: 789 PPVLPPPTMKVSAQVYTLQQSPVLELD-PA--IEDYFSAARKQPSSSTIASDFQELD 842


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,447,185
Number of Sequences: 53049
Number of extensions: 509072
Number of successful extensions: 1928
Number of sequences better than 10.0: 22
Number of HSP's better than 10.0 without gapping: 1784
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1913
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2151905496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -