SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B12
         (402 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-2108|AAF48428.1|   93|Drosophila melanogaster CG9091-PA...   136   1e-32
AE013599-3544|AAF46957.1|   89|Drosophila melanogaster CG9873-PA...   108   3e-24
BT023213-1|AAY55629.1|   89|Drosophila melanogaster IP02962p pro...   104   5e-23
BT023224-1|AAY55640.1|  103|Drosophila melanogaster IP02862p pro...    54   7e-08
BT023192-1|AAY55608.1|   78|Drosophila melanogaster IP03162p pro...    40   0.002
AE014296-2144|AAF49916.1|  733|Drosophila melanogaster CG10663-P...    27   7.1  
AY070652-1|AAL48123.1|  357|Drosophila melanogaster RH03777p pro...    27   9.4  
AY070651-1|AAL48122.1|  357|Drosophila melanogaster RH03711p pro...    27   9.4  

>AE014298-2108|AAF48428.1|   93|Drosophila melanogaster CG9091-PA
           protein.
          Length = 93

 Score =  136 bits (328), Expect = 1e-32
 Identities = 61/80 (76%), Positives = 65/80 (81%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHTLCRRCGRSSYHIQKS CAQCGYPAAKLRSY+WSVKA          M+HLK+VRR
Sbjct: 13  NKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTGTGRMQHLKVVRR 72

Query: 248 RFRNGFKEGKPTPPKKAVAS 307
           RFRNGF+EG    PKKAVAS
Sbjct: 73  RFRNGFREGTQAKPKKAVAS 92


>AE013599-3544|AAF46957.1|   89|Drosophila melanogaster CG9873-PA
           protein.
          Length = 89

 Score =  108 bits (259), Expect = 3e-24
 Identities = 46/69 (66%), Positives = 54/69 (78%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHT+CRRCG SSYH+QKSKC+QCGYPAAK RS++WS KA          MR+LK +RR
Sbjct: 13  NKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQGTGRMRYLKNLRR 72

Query: 248 RFRNGFKEG 274
           RFRNG +EG
Sbjct: 73  RFRNGLREG 81


>BT023213-1|AAY55629.1|   89|Drosophila melanogaster IP02962p
           protein.
          Length = 89

 Score =  104 bits (249), Expect = 5e-23
 Identities = 45/69 (65%), Positives = 53/69 (76%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAXXXXXXXXXXMRHLKIVRR 247
           NKTHT+CRRCG SSYH+QKSKC+Q GYPAAK RS++WS KA          MR+LK +RR
Sbjct: 13  NKTHTICRRCGNSSYHLQKSKCSQSGYPAAKTRSFNWSRKAKGRKAQGTGRMRYLKNLRR 72

Query: 248 RFRNGFKEG 274
           RFRNG +EG
Sbjct: 73  RFRNGLREG 81


>BT023224-1|AAY55640.1|  103|Drosophila melanogaster IP02862p
           protein.
          Length = 103

 Score = 54.0 bits (124), Expect = 7e-08
 Identities = 20/24 (83%), Positives = 23/24 (95%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYHIQKSKCAQ 139
           NKTHT+CRRCG SSYH+QKSKC+Q
Sbjct: 13  NKTHTICRRCGNSSYHLQKSKCSQ 36


>BT023192-1|AAY55608.1|   78|Drosophila melanogaster IP03162p
           protein.
          Length = 78

 Score = 39.5 bits (88), Expect = 0.002
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +2

Query: 68  NKTHTLCRRCGRSSYH 115
           NKTHT+CRRCG SSYH
Sbjct: 13  NKTHTICRRCGNSSYH 28


>AE014296-2144|AAF49916.1|  733|Drosophila melanogaster CG10663-PA
           protein.
          Length = 733

 Score = 27.5 bits (58), Expect = 7.1
 Identities = 10/26 (38%), Positives = 19/26 (73%)
 Frame = +2

Query: 89  RRCGRSSYHIQKSKCAQCGYPAAKLR 166
           R+CG +  H+++SKC+ C +PA  ++
Sbjct: 74  RKCGHTK-HVEQSKCSHC-HPAPAIK 97


>AY070652-1|AAL48123.1|  357|Drosophila melanogaster RH03777p
           protein.
          Length = 357

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 18/66 (27%), Positives = 27/66 (40%), Gaps = 1/66 (1%)
 Frame = +3

Query: 81  RYAEDVVDRHITFKNQNAPNVDILQQNYDPTTGQ*RLSAGRLL-ELAACVI*RLSGGASV 257
           RY +   D  +       P+ D     YDP TG+     G +   L    +  L GG+ +
Sbjct: 128 RYVKSRDDEQLLGHLSQTPSTDCAPFAYDPDTGKPIAPCGAIANSLFNDTLTLLQGGSEI 187

Query: 258 MVLKKG 275
            +LK G
Sbjct: 188 KLLKTG 193


>AY070651-1|AAL48122.1|  357|Drosophila melanogaster RH03711p
           protein.
          Length = 357

 Score = 27.1 bits (57), Expect = 9.4
 Identities = 18/66 (27%), Positives = 27/66 (40%), Gaps = 1/66 (1%)
 Frame = +3

Query: 81  RYAEDVVDRHITFKNQNAPNVDILQQNYDPTTGQ*RLSAGRLL-ELAACVI*RLSGGASV 257
           RY +   D  +       P+ D     YDP TG+     G +   L    +  L GG+ +
Sbjct: 128 RYVKSRDDEQLLGHLSQTPSTDCAPFAYDPDTGKPIAPCGAIANSLFNDTLTLLQGGSEI 187

Query: 258 MVLKKG 275
            +LK G
Sbjct: 188 KLLKTG 193


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,853,664
Number of Sequences: 53049
Number of extensions: 274276
Number of successful extensions: 876
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 856
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 876
length of database: 24,988,368
effective HSP length: 77
effective length of database: 20,903,595
effective search space used: 1170601320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -