SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B11
         (654 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

M22536-1|AAA28998.1|  156|Drosophila melanogaster protein ( D.me...   239   3e-63
BT001653-1|AAN71408.1|  156|Drosophila melanogaster RE44350p pro...   239   3e-63
AE014134-1875|AAF52941.1|  156|Drosophila melanogaster CG5271-PA...   239   3e-63
X69119-1|CAA48871.1|   76|Drosophila melanogaster Ubiquitin-80 p...   141   9e-34
X59943-1|CAA42568.1|  128|Drosophila melanogaster ubiquitin exte...   141   9e-34
X53059-1|CAA37227.1|  128|Drosophila melanogaster protein ( Frui...   141   9e-34
M33122-1|AAA29007.1|   76|Drosophila melanogaster protein ( D.me...   141   9e-34
M33015-1|AAA29001.1|   76|Drosophila melanogaster protein ( D.me...   141   9e-34
M33013-1|AAA28999.1|   76|Drosophila melanogaster protein ( D.me...   141   9e-34
M22428-1|AAA28997.1|  231|Drosophila melanogaster protein ( D.me...   141   9e-34
AY118702-1|AAM50562.1| 1067|Drosophila melanogaster AT20865p pro...   141   9e-34
AY118459-1|AAM49828.1|  306|Drosophila melanogaster GH17513p pro...   141   9e-34
AY075451-1|AAL68264.1|  128|Drosophila melanogaster RE10554p pro...   141   9e-34
AE014298-864|AAF46142.3|  534|Drosophila melanogaster CG32744-PA...   141   9e-34
AE014296-712|AAS64964.1|  763|Drosophila melanogaster CG11624-PC...   141   9e-34
AE014296-711|AAG22241.2|  763|Drosophila melanogaster CG11624-PB...   141   9e-34
AE014296-710|AAF47806.3|  763|Drosophila melanogaster CG11624-PA...   141   9e-34
AE014134-712|AAF51034.1|  128|Drosophila melanogaster CG2960-PA ...   141   9e-34
M33016-1|AAA29002.1|   76|Drosophila melanogaster protein ( D.me...   139   3e-33
M33014-1|AAA29000.1|   76|Drosophila melanogaster protein ( D.me...   139   3e-33
M33121-1|AAA29006.1|   76|Drosophila melanogaster protein ( D.me...   138   5e-33
M33018-1|AAA29004.1|   76|Drosophila melanogaster protein ( D.me...   136   2e-32
AE014298-866|AAF46143.1|  301|Drosophila melanogaster CG11700-PA...   136   2e-32
M33019-1|AAA29005.1|   75|Drosophila melanogaster protein ( D.me...   134   1e-31
M33017-1|AAA29003.1|   76|Drosophila melanogaster protein ( D.me...   134   1e-31
BT024445-1|ABC86507.1|   84|Drosophila melanogaster IP01714p pro...    91   1e-18
AE014134-2997|AAF53724.1|   84|Drosophila melanogaster CG10679-P...    91   1e-18
M37610-1|AAA28826.1|  152|Drosophila melanogaster protein ( D.me...    77   2e-14
M37609-1|AAA28825.1|  152|Drosophila melanogaster protein ( D.me...    73   5e-13
M37606-1|AAA28822.1|   75|Drosophila melanogaster protein ( D.me...    65   9e-11
AY093423-1|AAM18800.2|  482|Drosophila melanogaster PARKIN protein.    64   2e-10
AY058754-1|AAL13983.1|  482|Drosophila melanogaster SD01679p pro...    64   2e-10
AF510072-1|AAM43930.1|  482|Drosophila melanogaster PARKIN protein.    64   2e-10
AE014296-3479|AAN12155.1|  482|Drosophila melanogaster CG10523-P...    64   2e-10
AE014296-3478|AAN12154.1|  482|Drosophila melanogaster CG10523-P...    64   2e-10
M37605-1|AAA28821.1|   76|Drosophila melanogaster protein ( D.me...    57   2e-08
AY261675-1|AAP20871.1|   86|Drosophila melanogaster PARKIN protein.    56   6e-08
AY047530-1|AAK77262.1|  784|Drosophila melanogaster GH03554p pro...    54   2e-07
AE014297-2286|AAF55372.1|  784|Drosophila melanogaster CG16941-P...    54   2e-07
M37608-1|AAA28824.1|   76|Drosophila melanogaster protein ( D.me...    53   4e-07
M37607-1|AAA28823.1|   76|Drosophila melanogaster protein ( D.me...    53   4e-07
AE014297-2445|AAF55498.1|  130|Drosophila melanogaster CG7215-PA...    52   9e-07
AY128447-1|AAM75040.1|  547|Drosophila melanogaster LD38919p pro...    44   2e-04
AF136606-1|AAD33695.1|  414|Drosophila melanogaster DHR23 protein.     44   2e-04
AF132147-1|AAD33594.1|  414|Drosophila melanogaster DNA repair p...    44   2e-04
AE014298-2913|AAF49003.1|  547|Drosophila melanogaster CG14224-P...    44   2e-04
AE014135-60|AAF59352.1|  414|Drosophila melanogaster CG1836-PA, ...    44   2e-04
BT023040-1|AAY55456.1|  163|Drosophila melanogaster IP04025p pro...    42   7e-04
BT023001-1|AAY55417.1|  141|Drosophila melanogaster IP04125p pro...    42   7e-04
BT022932-1|AAY55348.1|  163|Drosophila melanogaster IP04325p pro...    42   7e-04
AE014298-1906|AAF48269.1|  163|Drosophila melanogaster CG12725-P...    42   7e-04
AY089339-1|AAL90077.1|  290|Drosophila melanogaster AT15685p pro...    41   0.001
AE014297-3457|AAF56234.1|  290|Drosophila melanogaster CG10694-P...    41   0.001
AY094669-1|AAM11022.1| 1122|Drosophila melanogaster GH03394p pro...    37   0.028
AE014298-1481|AAF46623.2| 1122|Drosophila melanogaster CG32676-P...    37   0.028
AE014296-1278|AAF50545.3| 1166|Drosophila melanogaster CG7546-PB...    36   0.064
AE014296-1277|AAF50546.2| 1332|Drosophila melanogaster CG7546-PA...    36   0.064
AY084174-1|AAL89912.1|  249|Drosophila melanogaster RE42193p pro...    33   0.26 
AE014297-243|AAF52034.1|  249|Drosophila melanogaster CG1172-PA ...    33   0.26 
AY089317-1|AAL90055.1|  291|Drosophila melanogaster AT12527p pro...    29   5.5  
AE014296-782|AAF47852.3|  291|Drosophila melanogaster CG18675-PA...    29   5.5  
AF132171-1|AAD34759.1|  320|Drosophila melanogaster unknown prot...    29   7.3  
AE014297-3265|AAF56091.1|  320|Drosophila melanogaster CG6697-PA...    29   7.3  

>M22536-1|AAA28998.1|  156|Drosophila melanogaster protein (
           D.melanogaster ubiquitin-hybrid (UB3-D) mRNA, complete
           cds. ).
          Length = 156

 Score =  239 bits (584), Expect = 3e-63
 Identities = 119/156 (76%), Positives = 125/156 (80%), Gaps = 1/156 (0%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            KNYSTP          KLAVL++YKVDENGKIHRLRRE
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVF-KDDDK 163
           C GE CGAGVFMA  EDRHYCGKC+ T VF K ++K
Sbjct: 121 CPGENCGAGVFMAAHEDRHYCGKCNLTFVFSKPEEK 156


>BT001653-1|AAN71408.1|  156|Drosophila melanogaster RE44350p
           protein.
          Length = 156

 Score =  239 bits (584), Expect = 3e-63
 Identities = 119/156 (76%), Positives = 125/156 (80%), Gaps = 1/156 (0%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            KNYSTP          KLAVL++YKVDENGKIHRLRRE
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVF-KDDDK 163
           C GE CGAGVFMA  EDRHYCGKC+ T VF K ++K
Sbjct: 121 CPGENCGAGVFMAAHEDRHYCGKCNLTFVFSKPEEK 156


>AE014134-1875|AAF52941.1|  156|Drosophila melanogaster CG5271-PA
           protein.
          Length = 156

 Score =  239 bits (584), Expect = 3e-63
 Identities = 119/156 (76%), Positives = 125/156 (80%), Gaps = 1/156 (0%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLVXXXXXXXXXXXXKNYSTPXXXXXXXXXXKLAVLRFYKVDENGKIHRLRRE 268
           IQKESTLHLV            KNYSTP          KLAVL++YKVDENGKIHRLRRE
Sbjct: 61  IQKESTLHLVLRLRGGAKKRKKKNYSTPKKIKHKRKKVKLAVLKYYKVDENGKIHRLRRE 120

Query: 267 CTGEQCGAGVFMAVMEDRHYCGKCHSTMVF-KDDDK 163
           C GE CGAGVFMA  EDRHYCGKC+ T VF K ++K
Sbjct: 121 CPGENCGAGVFMAAHEDRHYCGKCNLTFVFSKPEEK 156


>X69119-1|CAA48871.1|   76|Drosophila melanogaster Ubiquitin-80
           protein.
          Length = 76

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>X59943-1|CAA42568.1|  128|Drosophila melanogaster ubiquitin
           extension protein protein.
          Length = 128

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>X53059-1|CAA37227.1|  128|Drosophila melanogaster protein ( Fruit
           fly mRNA for ubiquitin52-AA extension protein. ).
          Length = 128

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>M33122-1|AAA29007.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>M33015-1|AAA29001.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>M33013-1|AAA28999.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>M22428-1|AAA28997.1|  231|Drosophila melanogaster protein (
           D.melanogaster ubiquitinprotein gene, complete cds. ).
          Length = 231

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222


>AY118702-1|AAM50562.1| 1067|Drosophila melanogaster AT20865p
           protein.
          Length = 1067

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 609 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 668

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 669 IQKESTLHLV 678



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 685 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 744

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 745 IQKESTLHLV 754



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 761 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 820

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 821 IQKESTLHLV 830



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 837  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 896

Query: 447  IQKESTLHLV 418
            IQKESTLHLV
Sbjct: 897  IQKESTLHLV 906



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 913  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 972

Query: 447  IQKESTLHLV 418
            IQKESTLHLV
Sbjct: 973  IQKESTLHLV 982



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
            MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 989  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 1048

Query: 447  IQKESTLHLV 418
            IQKESTLHLV
Sbjct: 1049 IQKESTLHLV 1058


>AY118459-1|AAM49828.1|  306|Drosophila melanogaster GH17513p
           protein.
          Length = 306

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298


>AY075451-1|AAL68264.1|  128|Drosophila melanogaster RE10554p
           protein.
          Length = 128

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>AE014298-864|AAF46142.3|  534|Drosophila melanogaster CG32744-PA
           protein.
          Length = 534

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526


>AE014296-712|AAS64964.1|  763|Drosophila melanogaster CG11624-PC,
           isoform C protein.
          Length = 763

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 609 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 668

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 669 IQKESTLHLV 678



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 685 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 744

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 745 IQKESTLHLV 754


>AE014296-711|AAG22241.2|  763|Drosophila melanogaster CG11624-PB,
           isoform B protein.
          Length = 763

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 609 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 668

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 669 IQKESTLHLV 678



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 685 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 744

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 745 IQKESTLHLV 754


>AE014296-710|AAF47806.3|  763|Drosophila melanogaster CG11624-PA,
           isoform A protein.
          Length = 763

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 137 IQKESTLHLV 146



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 289 IQKESTLHLV 298



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 305 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 364

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 365 IQKESTLHLV 374



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 381 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 440

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 441 IQKESTLHLV 450



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 457 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 516

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 517 IQKESTLHLV 526



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 533 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 592

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 593 IQKESTLHLV 602



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 609 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 668

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 669 IQKESTLHLV 678



 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 685 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 744

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 745 IQKESTLHLV 754


>AE014134-712|AAF51034.1|  128|Drosophila melanogaster CG2960-PA
           protein.
          Length = 128

 Score =  141 bits (341), Expect = 9e-34
 Identities = 68/70 (97%), Positives = 69/70 (98%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>M33016-1|AAA29002.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  139 bits (336), Expect = 3e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDT ENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTXENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>M33014-1|AAA29000.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  139 bits (336), Expect = 3e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDT ENVKAKIQDKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTTENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>M33121-1|AAA29006.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  138 bits (335), Expect = 5e-33
 Identities = 67/70 (95%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRL FAGK LEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKXLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>M33018-1|AAA29004.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  136 bits (330), Expect = 2e-32
 Identities = 66/70 (94%), Positives = 67/70 (95%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG PP+QQRL FAGK LEDGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGXPPDQQRLIFAGKXLEDGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>AE014298-866|AAF46143.1|  301|Drosophila melanogaster CG11700-PA
           protein.
          Length = 301

 Score =  136 bits (329), Expect = 2e-32
 Identities = 65/70 (92%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSD+IENVKA+I DKEGIPP+QQRL FAGKQLEDGRTLSDYN
Sbjct: 153 MQIFVKTLTGKTITLEVEPSDSIENVKARIHDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 213 IQKESTLHLV 222



 Score =  128 bits (308), Expect = 9e-30
 Identities = 60/68 (88%), Positives = 65/68 (95%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTI++VKA+I DK+GIPP+ QRL FAGKQLEDGRTLSDYN
Sbjct: 229 MQIFVKTLTGKTITLEVEPSDTIKHVKARIHDKDGIPPDHQRLIFAGKQLEDGRTLSDYN 288

Query: 447 IQKESTLH 424
           IQKESTLH
Sbjct: 289 IQKESTLH 296



 Score =  124 bits (298), Expect = 1e-28
 Identities = 60/70 (85%), Positives = 63/70 (90%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE  PP  QRL F GK LE+GRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKEST++LV
Sbjct: 61  IQKESTIYLV 70



 Score =  124 bits (298), Expect = 1e-28
 Identities = 60/70 (85%), Positives = 63/70 (90%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKE  PP  QRL F GK LE+GRTLSDYN
Sbjct: 77  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEENPPEHQRLIFGGKHLENGRTLSDYN 136

Query: 447 IQKESTLHLV 418
           IQKEST++LV
Sbjct: 137 IQKESTIYLV 146


>M33019-1|AAA29005.1|   75|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 75

 Score =  134 bits (323), Expect = 1e-31
 Identities = 66/70 (94%), Positives = 68/70 (97%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQR+ FAGKQL DGRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRI-FAGKQLXDGRTLSDYN 59

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 60  IQKESTLHLV 69


>M33017-1|AAA29003.1|   76|Drosophila melanogaster protein (
           D.melanogaster ubiquitingene, 5' end. ).
          Length = 76

 Score =  134 bits (323), Expect = 1e-31
 Identities = 65/70 (92%), Positives = 66/70 (94%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           MQIFVKTLTGKTITLEVEPSDT ENVKAKIQDKEGIPP+QQRL FAGKQL  GRTLSDYN
Sbjct: 1   MQIFVKTLTGKTITLEVEPSDTXENVKAKIQDKEGIPPDQQRLIFAGKQLXXGRTLSDYN 60

Query: 447 IQKESTLHLV 418
           IQKESTLHLV
Sbjct: 61  IQKESTLHLV 70


>BT024445-1|ABC86507.1|   84|Drosophila melanogaster IP01714p
           protein.
          Length = 84

 Score = 91.1 bits (216), Expect = 1e-18
 Identities = 38/70 (54%), Positives = 54/70 (77%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKTLTGK I +++EP+D ++ +K ++++KEGIPP QQRL F+GKQ+ D +T +DY 
Sbjct: 1   MLIKVKTLTGKEIEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYK 60

Query: 447 IQKESTLHLV 418
           +Q  S LHLV
Sbjct: 61  VQGGSVLHLV 70


>AE014134-2997|AAF53724.1|   84|Drosophila melanogaster CG10679-PA
           protein.
          Length = 84

 Score = 91.1 bits (216), Expect = 1e-18
 Identities = 38/70 (54%), Positives = 54/70 (77%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           M I VKTLTGK I +++EP+D ++ +K ++++KEGIPP QQRL F+GKQ+ D +T +DY 
Sbjct: 1   MLIKVKTLTGKEIEIDIEPTDKVDRIKERVEEKEGIPPQQQRLIFSGKQMNDDKTAADYK 60

Query: 447 IQKESTLHLV 418
           +Q  S LHLV
Sbjct: 61  VQGGSVLHLV 70


>M37610-1|AAA28826.1|  152|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 152

 Score = 77.0 bits (181), Expect = 2e-14
 Identities = 36/75 (48%), Positives = 53/75 (70%)
 Frame = +1

Query: 403 TTKPQHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLDL 582
           TT+ ++QV+GG LLD+V+  G S+   L+ + Q LLI  DSL +LN   HIL+G+  L L
Sbjct: 17  TTETKNQVKGGLLLDVVIGQGASVXXXLAGEDQTLLIWGDSLLILNLGLHILNGVRWLYL 76

Query: 583 KGDGLAREGLYENLH 627
           +GDGL+ + L+E+LH
Sbjct: 77  EGDGLSGQSLHEDLH 91



 Score = 42.3 bits (95), Expect = 6e-04
 Identities = 23/58 (39%), Positives = 28/58 (48%)
 Frame = +3

Query: 408 EASTPGGGWIPSGYCSPXGYVHLPAAFQQXSTSVDWEGFPLCLEF*LSHSRWYLTARP 581
           E   P  GW PSG C+  G VH  AA ++ S + D   FP   E    HS+W   A P
Sbjct: 95  ETXEPSEGWTPSGCCNRTGCVHPQAACRRRSDAADLGEFPPYPESWPLHSQWCPMALP 152


>M37609-1|AAA28825.1|  152|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 152

 Score = 72.5 bits (170), Expect = 5e-13
 Identities = 35/75 (46%), Positives = 51/75 (68%)
 Frame = +1

Query: 403 TTKPQHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI*RLDL 582
           TT+ ++QV+GG LLD+V+  G S    L+ + Q LLI   SL +LN   HIL+G+  L L
Sbjct: 17  TTETKNQVKGGLLLDVVIGQGASXXXXLAGEDQTLLIWGXSLLILNLGLHILNGVRWLYL 76

Query: 583 KGDGLAREGLYENLH 627
           +GDGL+ + L+E+LH
Sbjct: 77  EGDGLSGQSLHEDLH 91



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 24/58 (41%), Positives = 29/58 (50%)
 Frame = +3

Query: 408 EASTPGGGWIPSGYCSPXGYVHLPAAFQQXSTSVDWEGFPLCLEF*LSHSRWYLTARP 581
           E   P  GW P G C+  G V LP A ++ S + D  GFP   E   SHS+W   A P
Sbjct: 95  ETXEPSEGWTPFGCCNRTGCVRLPVACRRRSDAADLGGFPPYPESWPSHSQWCPMALP 152


>M37606-1|AAA28822.1|   75|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 75

 Score = 64.9 bits (151), Expect = 9e-11
 Identities = 29/55 (52%), Positives = 42/55 (76%)
 Frame = +1

Query: 403 TTKPQHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI 567
           TT+ ++QV+GG LLD+V+  G S+FQLL+S+ Q LLI  DSL +LN   +IL+G+
Sbjct: 17  TTETKNQVKGGLLLDVVIGQGASVFQLLASEDQTLLIWGDSLLILNLGLYILNGV 71


>AY093423-1|AAM18800.2|  482|Drosophila melanogaster PARKIN protein.
          Length = 482

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I+VKT TGKT+T+ +EP   I+NVK  +  + G+ P+  ++ FAGK+L D  T+   +
Sbjct: 30  LSIYVKTNTGKTLTVNLEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCD 89

Query: 447 IQKESTLHLV 418
           + ++S LH +
Sbjct: 90  LGQQSVLHAI 99


>AY058754-1|AAL13983.1|  482|Drosophila melanogaster SD01679p
           protein.
          Length = 482

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I+VKT TGKT+T+ +EP   I+NVK  +  + G+ P+  ++ FAGK+L D  T+   +
Sbjct: 30  LSIYVKTNTGKTLTVNLEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCD 89

Query: 447 IQKESTLHLV 418
           + ++S LH +
Sbjct: 90  LGQQSVLHAI 99


>AF510072-1|AAM43930.1|  482|Drosophila melanogaster PARKIN protein.
          Length = 482

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I+VKT TGKT+T+ +EP   I+NVK  +  + G+ P+  ++ FAGK+L D  T+   +
Sbjct: 30  LSIYVKTNTGKTLTVNLEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCD 89

Query: 447 IQKESTLHLV 418
           + ++S LH +
Sbjct: 90  LGQQSVLHAI 99


>AE014296-3479|AAN12155.1|  482|Drosophila melanogaster CG10523-PC,
           isoform C protein.
          Length = 482

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I+VKT TGKT+T+ +EP   I+NVK  +  + G+ P+  ++ FAGK+L D  T+   +
Sbjct: 30  LSIYVKTNTGKTLTVNLEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCD 89

Query: 447 IQKESTLHLV 418
           + ++S LH +
Sbjct: 90  LGQQSVLHAI 99


>AE014296-3478|AAN12154.1|  482|Drosophila melanogaster CG10523-PB,
           isoform B protein.
          Length = 482

 Score = 63.7 bits (148), Expect = 2e-10
 Identities = 27/70 (38%), Positives = 46/70 (65%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYN 448
           + I+VKT TGKT+T+ +EP   I+NVK  +  + G+ P+  ++ FAGK+L D  T+   +
Sbjct: 30  LSIYVKTNTGKTLTVNLEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTIEQCD 89

Query: 447 IQKESTLHLV 418
           + ++S LH +
Sbjct: 90  LGQQSVLHAI 99


>M37605-1|AAA28821.1|   76|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 76

 Score = 57.2 bits (132), Expect = 2e-08
 Identities = 26/51 (50%), Positives = 36/51 (70%)
 Frame = +1

Query: 415 QHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI 567
           ++QV+GG LLD+V+  G SI +LL+ + Q LLI  DSL +LN   HIL G+
Sbjct: 22  RNQVKGGLLLDVVIGQGASILKLLAGEDQTLLIWGDSLLILNLGLHILGGV 72



 Score = 33.1 bits (72), Expect = 0.34
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +2

Query: 581 SRVMVLPVRVFTKICI 628
           SRVMV PV+VFTKICI
Sbjct: 1   SRVMVFPVKVFTKICI 16


>AY261675-1|AAP20871.1|   86|Drosophila melanogaster PARKIN protein.
          Length = 86

 Score = 55.6 bits (128), Expect = 6e-08
 Identities = 24/56 (42%), Positives = 38/56 (67%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTL 460
           + I+VKT TGKT+T+ +EP   I+NVK  +  + G+ P+  ++ FAGK+L D  T+
Sbjct: 30  LSIYVKTNTGKTLTVNLEPQWDIKNVKELVAPQLGLQPDDLKIIFAGKELSDATTI 85


>AY047530-1|AAK77262.1|  784|Drosophila melanogaster GH03554p
           protein.
          Length = 784

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 22/62 (35%), Positives = 40/62 (64%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L G+ I + +  S+ I N+K K+QD+ G+PP +Q++ + G   +D  T++ YN+   +T+
Sbjct: 713 LNGQMIAVTMALSEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFYNLVNGTTV 772

Query: 426 HL 421
           HL
Sbjct: 773 HL 774


>AE014297-2286|AAF55372.1|  784|Drosophila melanogaster CG16941-PA
           protein.
          Length = 784

 Score = 53.6 bits (123), Expect = 2e-07
 Identities = 22/62 (35%), Positives = 40/62 (64%)
 Frame = -1

Query: 606 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKESTL 427
           L G+ I + +  S+ I N+K K+QD+ G+PP +Q++ + G   +D  T++ YN+   +T+
Sbjct: 713 LNGQMIAVTMALSEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFYNLVNGTTV 772

Query: 426 HL 421
           HL
Sbjct: 773 HL 774


>M37608-1|AAA28824.1|   76|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 76

 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 24/51 (47%), Positives = 36/51 (70%)
 Frame = +1

Query: 415 QHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI 567
           ++QV+GG LLD+V+  G SI +LL+ + Q LLI  +SL +LN   +IL G+
Sbjct: 22  RNQVKGGLLLDVVIGQGASILKLLAGEDQTLLIWGNSLLILNLGLYILXGV 72



 Score = 33.1 bits (72), Expect = 0.34
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +2

Query: 581 SRVMVLPVRVFTKICI 628
           SRVMV PV+VFTKICI
Sbjct: 1   SRVMVFPVKVFTKICI 16


>M37607-1|AAA28823.1|   76|Drosophila melanogaster protein (
           D.melanogaster polytenegene, partial cds. ).
          Length = 76

 Score = 52.8 bits (121), Expect = 4e-07
 Identities = 24/51 (47%), Positives = 36/51 (70%)
 Frame = +1

Query: 415 QHQVEGGFLLDIVVRXGTSIFQLLSSKXQPLLIGRDSLFVLNFSFHILDGI 567
           ++QV+GG LLD+V+  G SI +LL+ + Q LLI  +SL +LN   +IL G+
Sbjct: 22  RNQVKGGLLLDVVIGQGASILKLLAGEDQTLLIWGNSLLILNLGLYILXGV 72



 Score = 33.1 bits (72), Expect = 0.34
 Identities = 14/16 (87%), Positives = 15/16 (93%)
 Frame = +2

Query: 581 SRVMVLPVRVFTKICI 628
           SRVMV PV+VFTKICI
Sbjct: 1   SRVMVFPVKVFTKICI 16


>AE014297-2445|AAF55498.1|  130|Drosophila melanogaster CG7215-PA,
           isoform A protein.
          Length = 130

 Score = 51.6 bits (118), Expect = 9e-07
 Identities = 28/71 (39%), Positives = 44/71 (61%), Gaps = 1/71 (1%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY- 451
           MQI +K L GK  T+EV P+ TI  VK +I+ +  I    Q+L   G+ L + +T++ Y 
Sbjct: 1   MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYP 60

Query: 450 NIQKESTLHLV 418
           NI++ + L+LV
Sbjct: 61  NIKEGTKLNLV 71


>AY128447-1|AAM75040.1|  547|Drosophila melanogaster LD38919p
           protein.
          Length = 547

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 26/71 (36%), Positives = 39/71 (54%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++ + VKT   K  T+EV+    I++ K  +  K    P Q  L FAGK ++D  TL  +
Sbjct: 8   RINVVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMH 66

Query: 450 NIQKESTLHLV 418
           NI+   T+HLV
Sbjct: 67  NIKDNLTVHLV 77


>AF136606-1|AAD33695.1|  414|Drosophila melanogaster DHR23 protein.
          Length = 414

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPNQQRLXFAGKQLEDGRTLSD 454
           M I +K L  +T T+E  P  T+  +K KI ++ G      +Q+L +AG  L D RT+  
Sbjct: 1   MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGS 60

Query: 453 YNIQKE 436
           YN+ ++
Sbjct: 61  YNVDEK 66


>AF132147-1|AAD33594.1|  414|Drosophila melanogaster DNA repair
           protein Rad23 protein.
          Length = 414

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPNQQRLXFAGKQLEDGRTLSD 454
           M I +K L  +T T+E  P  T+  +K KI ++ G      +Q+L +AG  L D RT+  
Sbjct: 1   MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGS 60

Query: 453 YNIQKE 436
           YN+ ++
Sbjct: 61  YNVDEK 66


>AE014298-2913|AAF49003.1|  547|Drosophila melanogaster CG14224-PA
           protein.
          Length = 547

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 26/71 (36%), Positives = 39/71 (54%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++ + VKT   K  T+EV+    I++ K  +  K    P Q  L FAGK ++D  TL  +
Sbjct: 8   RINVVVKTPKDKK-TVEVDEDSGIKDFKILVAQKFEAEPEQLVLIFAGKIMKDTDTLQMH 66

Query: 450 NIQKESTLHLV 418
           NI+   T+HLV
Sbjct: 67  NIKDNLTVHLV 77


>AE014135-60|AAF59352.1|  414|Drosophila melanogaster CG1836-PA,
           isoform A protein.
          Length = 414

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 2/66 (3%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG--IPPNQQRLXFAGKQLEDGRTLSD 454
           M I +K L  +T T+E  P  T+  +K KI ++ G      +Q+L +AG  L D RT+  
Sbjct: 1   MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGVILTDDRTVGS 60

Query: 453 YNIQKE 436
           YN+ ++
Sbjct: 61  YNVDEK 66


>BT023040-1|AAY55456.1|  163|Drosophila melanogaster IP04025p
           protein.
          Length = 163

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           KMQ+ V+T  GK    +V+   T+ N+KA+I     +P    RL + G++L +   L D
Sbjct: 3   KMQVLVQTSDGKKTVYDVDRFGTVANLKARIGRAMSVPMGFSRLSYKGRELSNQSILED 61


>BT023001-1|AAY55417.1|  141|Drosophila melanogaster IP04125p
           protein.
          Length = 141

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           KMQ+ V+T  GK    +V+   T+ N+KA+I     +P    RL + G++L +   L D
Sbjct: 41  KMQVLVQTSDGKKTVYDVDRFGTVANLKARIGRAMSVPMGFSRLSYKGRELSNQSILED 99


>BT022932-1|AAY55348.1|  163|Drosophila melanogaster IP04325p
           protein.
          Length = 163

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           KMQ+ V+T  GK    +V+   T+ N+KA+I     +P    RL + G++L +   L D
Sbjct: 3   KMQVLVQTSDGKKTVYDVDRFGTVANLKARIGRAMSVPMGFSRLSYKGRELSNQSILED 61


>AE014298-1906|AAF48269.1|  163|Drosophila melanogaster CG12725-PA
           protein.
          Length = 163

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = -1

Query: 630 KMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSD 454
           KMQ+ V+T  GK    +V+   T+ N+KA+I     +P    RL + G++L +   L D
Sbjct: 3   KMQVLVQTSDGKKTVYDVDRFGTVANLKARIGRAMSVPMGFSRLSYKGRELSNQSILED 61


>AY089339-1|AAL90077.1|  290|Drosophila melanogaster AT15685p
           protein.
          Length = 290

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD--KEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M++ ++ L  +TITLE+  S  +  +K K+ +  +  +P    +L ++G+ +ED   LS+
Sbjct: 1   MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSE 60

Query: 453 YNIQKESTLHLV 418
           Y I ++  + L+
Sbjct: 61  YRIAEDKIIVLM 72


>AE014297-3457|AAF56234.1|  290|Drosophila melanogaster CG10694-PA
           protein.
          Length = 290

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 20/72 (27%), Positives = 42/72 (58%), Gaps = 2/72 (2%)
 Frame = -1

Query: 627 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD--KEGIPPNQQRLXFAGKQLEDGRTLSD 454
           M++ ++ L  +TITLE+  S  +  +K K+ +  +  +P    +L ++G+ +ED   LS+
Sbjct: 1   MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSE 60

Query: 453 YNIQKESTLHLV 418
           Y I ++  + L+
Sbjct: 61  YRIAEDKIIVLM 72


>AY094669-1|AAM11022.1| 1122|Drosophila melanogaster GH03394p
           protein.
          Length = 1122

 Score = 36.7 bits (81), Expect = 0.028
 Identities = 21/66 (31%), Positives = 36/66 (54%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           + T TG    + VEP  ++E++K  I  K  +  ++  L    K+L+DG TL D+N+   
Sbjct: 73  ISTTTGGNFGVSVEPHISVESLKKIIAKKLKVAKDRICLLHREKELQDG-TLRDHNLMDG 131

Query: 435 STLHLV 418
           S + L+
Sbjct: 132 SKIILI 137


>AE014298-1481|AAF46623.2| 1122|Drosophila melanogaster CG32676-PA
           protein.
          Length = 1122

 Score = 36.7 bits (81), Expect = 0.028
 Identities = 21/66 (31%), Positives = 36/66 (54%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           + T TG    + VEP  ++E++K  I  K  +  ++  L    K+L+DG TL D+N+   
Sbjct: 73  ISTTTGGNFGVSVEPHISVESLKKIIAKKLKVAKDRICLLHREKELQDG-TLRDHNLMDG 131

Query: 435 STLHLV 418
           S + L+
Sbjct: 132 SKIILI 137


>AE014296-1278|AAF50545.3| 1166|Drosophila melanogaster CG7546-PB,
           isoform B protein.
          Length = 1166

 Score = 35.5 bits (78), Expect = 0.064
 Identities = 18/65 (27%), Positives = 33/65 (50%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           VKTL  +     ++   TI   K +I +K  I    QR+ + G+ L D + + +Y++  +
Sbjct: 7   VKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVDGK 66

Query: 435 STLHL 421
             LH+
Sbjct: 67  -VLHV 70


>AE014296-1277|AAF50546.2| 1332|Drosophila melanogaster CG7546-PA,
           isoform A protein.
          Length = 1332

 Score = 35.5 bits (78), Expect = 0.064
 Identities = 18/65 (27%), Positives = 33/65 (50%)
 Frame = -1

Query: 615 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDYNIQKE 436
           VKTL  +     ++   TI   K +I +K  I    QR+ + G+ L D + + +Y++  +
Sbjct: 7   VKTLDARIHEFSIDNELTIRQFKDQIAEKTNIAAENQRIIYQGRVLVDDKQVKEYDVDGK 66

Query: 435 STLHL 421
             LH+
Sbjct: 67  -VLHV 70


>AY084174-1|AAL89912.1|  249|Drosophila melanogaster RE42193p
           protein.
          Length = 249

 Score = 33.5 bits (73), Expect = 0.26
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 3/71 (4%)
 Frame = -1

Query: 621 IFVKTLTGKTIT---LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           IF+K     T+T   L V   DT+   K K+Q  EG+    QR  ++GK L D   + + 
Sbjct: 161 IFLKLRISSTMTDVKLPVYSKDTVGQCKKKLQAAEGVDACCQRWFYSGKLLGDKVPIDEC 220

Query: 450 NIQKESTLHLV 418
           +I +   + ++
Sbjct: 221 SIHQGYVVQVI 231


>AE014297-243|AAF52034.1|  249|Drosophila melanogaster CG1172-PA
           protein.
          Length = 249

 Score = 33.5 bits (73), Expect = 0.26
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 3/71 (4%)
 Frame = -1

Query: 621 IFVKTLTGKTIT---LEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           IF+K     T+T   L V   DT+   K K+Q  EG+    QR  ++GK L D   + + 
Sbjct: 161 IFLKLRISSTMTDVKLPVYSKDTVGQCKKKLQAAEGVDACCQRWFYSGKLLGDKVPIDEC 220

Query: 450 NIQKESTLHLV 418
           +I +   + ++
Sbjct: 221 SIHQGYVVQVI 231


>AY089317-1|AAL90055.1|  291|Drosophila melanogaster AT12527p
           protein.
          Length = 291

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 15/46 (32%), Positives = 28/46 (60%)
 Frame = -1

Query: 588 TLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++ +E ++T E++      KE I P++ +  FAG Q+  G+ +SDY
Sbjct: 163 SIRMEFTNT-EDLTGTQASKEVIEPSKAQFWFAGHQMLMGKLMSDY 207


>AE014296-782|AAF47852.3|  291|Drosophila melanogaster CG18675-PA
           protein.
          Length = 291

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 15/46 (32%), Positives = 28/46 (60%)
 Frame = -1

Query: 588 TLEVEPSDTIENVKAKIQDKEGIPPNQQRLXFAGKQLEDGRTLSDY 451
           ++ +E ++T E++      KE I P++ +  FAG Q+  G+ +SDY
Sbjct: 163 SIRMEFTNT-EDLTGTQASKEVIEPSKAQFWFAGHQMLMGKLMSDY 207


>AF132171-1|AAD34759.1|  320|Drosophila melanogaster unknown
           protein.
          Length = 320

 Score = 28.7 bits (61), Expect = 7.3
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 3/75 (4%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQR---LXFAGKQLEDGRT 463
           VK  + +   +GK   +++   DT+E ++ +I  K  + P +Q+   L + GK   D   
Sbjct: 3   VKEVVVIVKWSGKEYPVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNLKYKGKTAADNVK 62

Query: 462 LSDYNIQKESTLHLV 418
           +S   ++    L +V
Sbjct: 63  ISALELKPNFKLMMV 77


>AE014297-3265|AAF56091.1|  320|Drosophila melanogaster CG6697-PA
           protein.
          Length = 320

 Score = 28.7 bits (61), Expect = 7.3
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 3/75 (4%)
 Frame = -1

Query: 633 VKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQR---LXFAGKQLEDGRT 463
           VK  + +   +GK   +++   DT+E ++ +I  K  + P +Q+   L + GK   D   
Sbjct: 3   VKEVVVIVKWSGKEYPVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNLKYKGKTAADNVK 62

Query: 462 LSDYNIQKESTLHLV 418
           +S   ++    L +V
Sbjct: 63  ISALELKPNFKLMMV 77


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,139,968
Number of Sequences: 53049
Number of extensions: 458418
Number of successful extensions: 1391
Number of sequences better than 10.0: 63
Number of HSP's better than 10.0 without gapping: 1244
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1390
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2786177250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -