SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B08
         (510 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY071239-1|AAL48861.1|   64|Drosophila melanogaster RE27904p pro...   111   4e-25
AE014296-593|AAN11541.1|   64|Drosophila melanogaster CG32276-PB...   111   4e-25
AE014296-592|AAN11540.1|   64|Drosophila melanogaster CG32276-PA...   111   4e-25
BT001439-1|AAN71194.1| 1040|Drosophila melanogaster GH25102p pro...    29   3.7  
AY060725-1|AAL28273.1|  515|Drosophila melanogaster GH17414p pro...    29   3.7  
AE013599-3262|AAF46757.2| 1040|Drosophila melanogaster CG17922-P...    29   3.7  
M81887-1|AAA28844.1| 2248|Drosophila melanogaster rutabaga adeny...    29   4.8  
AY052147-1|AAK93571.1|  531|Drosophila melanogaster SD10674p pro...    29   4.8  
AE014298-2053|AAF48388.1| 2248|Drosophila melanogaster CG9533-PA...    29   4.8  
AE014296-2747|AAG22318.1|  531|Drosophila melanogaster CG32158-P...    29   4.8  
AE014296-2746|AAG22317.1|  533|Drosophila melanogaster CG32158-P...    29   4.8  
AE014296-2745|AAF49456.1|  533|Drosophila melanogaster CG32158-P...    29   4.8  

>AY071239-1|AAL48861.1|   64|Drosophila melanogaster RE27904p
           protein.
          Length = 64

 Score =  111 bits (268), Expect = 4e-25
 Identities = 51/64 (79%), Positives = 57/64 (89%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           MAP QRMR+ANE ASK +TMRGNVPK++K KE QYPV PWLLALFIFVVCGSA+FQI+QS
Sbjct: 1   MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQS 60

Query: 280 IRLA 291
           IR A
Sbjct: 61  IRAA 64


>AE014296-593|AAN11541.1|   64|Drosophila melanogaster CG32276-PB,
           isoform B protein.
          Length = 64

 Score =  111 bits (268), Expect = 4e-25
 Identities = 51/64 (79%), Positives = 57/64 (89%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           MAP QRMR+ANE ASK +TMRGNVPK++K KE QYPV PWLLALFIFVVCGSA+FQI+QS
Sbjct: 1   MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQS 60

Query: 280 IRLA 291
           IR A
Sbjct: 61  IRAA 64


>AE014296-592|AAN11540.1|   64|Drosophila melanogaster CG32276-PA,
           isoform A protein.
          Length = 64

 Score =  111 bits (268), Expect = 4e-25
 Identities = 51/64 (79%), Positives = 57/64 (89%)
 Frame = +1

Query: 100 MAPKQRMRIANEIASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           MAP QRMR+ANE ASK +TMRGNVPK++K KE QYPV PWLLALFIFVVCGSA+FQI+QS
Sbjct: 1   MAPPQRMRVANEKASKYVTMRGNVPKSSKTKEGQYPVGPWLLALFIFVVCGSAIFQIVQS 60

Query: 280 IRLA 291
           IR A
Sbjct: 61  IRAA 64


>BT001439-1|AAN71194.1| 1040|Drosophila melanogaster GH25102p
           protein.
          Length = 1040

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/47 (27%), Positives = 23/47 (48%)
 Frame = +1

Query: 139 ASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           A+K  T  G  PK  ++ E  +    WL+ +F+F +    +  II +
Sbjct: 652 ATKTATSIGKNPKPERQGEYVFMTVAWLMGVFVFALLIGQIRDIIST 698


>AY060725-1|AAL28273.1|  515|Drosophila melanogaster GH17414p
           protein.
          Length = 515

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/47 (27%), Positives = 23/47 (48%)
 Frame = +1

Query: 139 ASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           A+K  T  G  PK  ++ E  +    WL+ +F+F +    +  II +
Sbjct: 127 ATKTATSIGKNPKPERQGEYVFMTVAWLMGVFVFALLIGQIRDIIST 173


>AE013599-3262|AAF46757.2| 1040|Drosophila melanogaster CG17922-PA
           protein.
          Length = 1040

 Score = 29.1 bits (62), Expect = 3.7
 Identities = 13/47 (27%), Positives = 23/47 (48%)
 Frame = +1

Query: 139 ASKNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGSAVFQIIQS 279
           A+K  T  G  PK  ++ E  +    WL+ +F+F +    +  II +
Sbjct: 652 ATKTATSIGKNPKPERQGEYVFMTVAWLMGVFVFALLIGQIRDIIST 698


>M81887-1|AAA28844.1| 2248|Drosophila melanogaster rutabaga adenylyl
           cyclase protein.
          Length = 2248

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 13/45 (28%), Positives = 25/45 (55%)
 Frame = -2

Query: 368 VPNFRWIVLLFYCVFDSSSPVVFVI*ASLIDWIIWNTAEPHTTKM 234
           +P    ++LLF   F   S ++ ++ A  + WIIW+ +E  + +M
Sbjct: 726 LPRTLILLLLFLFAFIWVSAILMLLLAVRLKWIIWDISESFSLRM 770


>AY052147-1|AAK93571.1|  531|Drosophila melanogaster SD10674p
           protein.
          Length = 531

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 4/55 (7%)
 Frame = -2

Query: 341 LFYCVFDSSSPVVFVI*ASLIDWIIWNT---AEPHTTKMKRA-RSQGATGYWSSF 189
           LFY VF+ S   +F + ASL+   I  T    +  TT  +R+ R  G  G+W  F
Sbjct: 236 LFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQTTPRQRSLRELGCCGFWGDF 290


>AE014298-2053|AAF48388.1| 2248|Drosophila melanogaster CG9533-PA
           protein.
          Length = 2248

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 13/45 (28%), Positives = 25/45 (55%)
 Frame = -2

Query: 368 VPNFRWIVLLFYCVFDSSSPVVFVI*ASLIDWIIWNTAEPHTTKM 234
           +P    ++LLF   F   S ++ ++ A  + WIIW+ +E  + +M
Sbjct: 726 LPRTLILLLLFLFAFIWVSAILMLLLAVRLKWIIWDISESFSLRM 770


>AE014296-2747|AAG22318.1|  531|Drosophila melanogaster CG32158-PD,
           isoform D protein.
          Length = 531

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 4/55 (7%)
 Frame = -2

Query: 341 LFYCVFDSSSPVVFVI*ASLIDWIIWNT---AEPHTTKMKRA-RSQGATGYWSSF 189
           LFY VF+ S   +F + ASL+   I  T    +  TT  +R+ R  G  G+W  F
Sbjct: 236 LFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQTTPRQRSLRELGCCGFWGDF 290


>AE014296-2746|AAG22317.1|  533|Drosophila melanogaster CG32158-PE,
           isoform E protein.
          Length = 533

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 4/55 (7%)
 Frame = -2

Query: 341 LFYCVFDSSSPVVFVI*ASLIDWIIWNT---AEPHTTKMKRA-RSQGATGYWSSF 189
           LFY VF+ S   +F + ASL+   I  T    +  TT  +R+ R  G  G+W  F
Sbjct: 238 LFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQTTPRQRSLRELGCCGFWGDF 292


>AE014296-2745|AAF49456.1|  533|Drosophila melanogaster CG32158-PC,
           isoform C protein.
          Length = 533

 Score = 28.7 bits (61), Expect = 4.8
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 4/55 (7%)
 Frame = -2

Query: 341 LFYCVFDSSSPVVFVI*ASLIDWIIWNT---AEPHTTKMKRA-RSQGATGYWSSF 189
           LFY VF+ S   +F + ASL+   I  T    +  TT  +R+ R  G  G+W  F
Sbjct: 238 LFYNVFNQSYADMFTVNASLLALAIIYTLCALKWQTTPRQRSLRELGCCGFWGDF 292


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,122,358
Number of Sequences: 53049
Number of extensions: 484073
Number of successful extensions: 1282
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1238
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1282
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1846255872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -