SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B07
         (652 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014297-1858|AAF55066.3| 1131|Drosophila melanogaster CG8279-PA...    30   2.4  
AY069806-1|AAL39951.1| 1157|Drosophila melanogaster SD04681p pro...    30   3.1  
AE014296-3555|AAN12171.1| 1157|Drosophila melanogaster CG7597-PB...    30   3.1  
AE014296-3554|AAF51738.1| 1157|Drosophila melanogaster CG7597-PA...    30   3.1  
AY069124-1|AAL39269.1|  469|Drosophila melanogaster GH13256p pro...    29   4.1  
AE013599-3710|AAF47083.1|  469|Drosophila melanogaster CG4581-PA...    29   4.1  
AE013599-1168|AAO41410.1|  413|Drosophila melanogaster CG30018-P...    29   4.1  
AB010262-1|BAA32690.1|  469|Drosophila melanogaster thiolase pro...    29   4.1  
AB010261-5|BAA32688.1|  469|Drosophila melanogaster thiolase pro...    29   4.1  

>AE014297-1858|AAF55066.3| 1131|Drosophila melanogaster CG8279-PA
           protein.
          Length = 1131

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 16/45 (35%), Positives = 22/45 (48%)
 Frame = -3

Query: 365 SSRSLNGAFKYHKHRSPPSANPSLATKGSTSKLTQPTEFLAGPSQ 231
           SS S N     H HR   +  P++  + S +KL  PT   + PSQ
Sbjct: 81  SSSSGNQVKLEHHHRQSNNNRPAVTNRSSETKLMTPTGSSSSPSQ 125


>AY069806-1|AAL39951.1| 1157|Drosophila melanogaster SD04681p
           protein.
          Length = 1157

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 5/86 (5%)
 Frame = -3

Query: 368 GSSRSLNGAFKYHKHRSPPSANPSLATKGSTSKLTQPTEFLAGPSQ*VFWFEPRKSTRPQ 189
           GS+   +G    HK+ +  S+ PS  T+  TSK    T    G S   +   PR S+R  
Sbjct: 428 GSNAFRHGGSHKHKYGTTVSSTPSHTTR--TSKRASGT----GTSGDRYSRSPRTSSRYM 481

Query: 188 ETDI-----ASQGYHYQHR*KKQSRQ 126
           E+       AS  +HY HR   + RQ
Sbjct: 482 ESSPPSPVGASGSHHYHHRRSPRMRQ 507


>AE014296-3555|AAN12171.1| 1157|Drosophila melanogaster CG7597-PB,
           isoform B protein.
          Length = 1157

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 5/86 (5%)
 Frame = -3

Query: 368 GSSRSLNGAFKYHKHRSPPSANPSLATKGSTSKLTQPTEFLAGPSQ*VFWFEPRKSTRPQ 189
           GS+   +G    HK+ +  S+ PS  T+  TSK    T    G S   +   PR S+R  
Sbjct: 428 GSNAFRHGGSHKHKYGTTVSSTPSHTTR--TSKRASGT----GTSGDRYSRSPRTSSRYM 481

Query: 188 ETDI-----ASQGYHYQHR*KKQSRQ 126
           E+       AS  +HY HR   + RQ
Sbjct: 482 ESSPPSPVGASGSHHYHHRRSPRMRQ 507


>AE014296-3554|AAF51738.1| 1157|Drosophila melanogaster CG7597-PA,
           isoform A protein.
          Length = 1157

 Score = 29.9 bits (64), Expect = 3.1
 Identities = 28/86 (32%), Positives = 39/86 (45%), Gaps = 5/86 (5%)
 Frame = -3

Query: 368 GSSRSLNGAFKYHKHRSPPSANPSLATKGSTSKLTQPTEFLAGPSQ*VFWFEPRKSTRPQ 189
           GS+   +G    HK+ +  S+ PS  T+  TSK    T    G S   +   PR S+R  
Sbjct: 428 GSNAFRHGGSHKHKYGTTVSSTPSHTTR--TSKRASGT----GTSGDRYSRSPRTSSRYM 481

Query: 188 ETDI-----ASQGYHYQHR*KKQSRQ 126
           E+       AS  +HY HR   + RQ
Sbjct: 482 ESSPPSPVGASGSHHYHHRRSPRMRQ 507


>AY069124-1|AAL39269.1|  469|Drosophila melanogaster GH13256p
           protein.
          Length = 469

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = -2

Query: 468 TYLGSEQ*VGTHFLCKVNRYSGSIHISEP 382
           TYLG  + VGT  L K N + GS+ I  P
Sbjct: 392 TYLGLNEKVGTPDLSKWNNWGGSLSIGHP 420


>AE013599-3710|AAF47083.1|  469|Drosophila melanogaster CG4581-PA
           protein.
          Length = 469

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = -2

Query: 468 TYLGSEQ*VGTHFLCKVNRYSGSIHISEP 382
           TYLG  + VGT  L K N + GS+ I  P
Sbjct: 392 TYLGLNEKVGTPDLSKWNNWGGSLSIGHP 420


>AE013599-1168|AAO41410.1|  413|Drosophila melanogaster CG30018-PC
           protein.
          Length = 413

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +1

Query: 433 MCTYLLFRAEVRIS-CNNDSGKCVPPRLLVLLIDSILFIPENIYLLGNIC 579
           +C  ++F   + +    ND GKCV   +  L +D ++++ + + LL + C
Sbjct: 177 ICYIIIFGIYLFVKELRNDFGKCVMSCVFCLFLDYLIWLMDELRLLDDFC 226


>AB010262-1|BAA32690.1|  469|Drosophila melanogaster thiolase
           protein.
          Length = 469

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = -2

Query: 468 TYLGSEQ*VGTHFLCKVNRYSGSIHISEP 382
           TYLG  + VGT  L K N + GS+ I  P
Sbjct: 392 TYLGLNEKVGTPDLSKWNNWGGSLSIGHP 420


>AB010261-5|BAA32688.1|  469|Drosophila melanogaster thiolase
           protein.
          Length = 469

 Score = 29.5 bits (63), Expect = 4.1
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = -2

Query: 468 TYLGSEQ*VGTHFLCKVNRYSGSIHISEP 382
           TYLG  + VGT  L K N + GS+ I  P
Sbjct: 392 TYLGLNEKVGTPDLSKWNNWGGSLSIGHP 420


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,693,901
Number of Sequences: 53049
Number of extensions: 595566
Number of successful extensions: 1757
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 1708
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1757
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2765538900
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -