SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B05
         (653 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U48394-1|AAB61633.1|  228|Drosophila melanogaster M(1)15D protein.    321   4e-88
AY075368-1|AAL68215.1|  228|Drosophila melanogaster GM13047p pro...   321   4e-88
AE014298-2526|AAF48700.1|  228|Drosophila melanogaster CG8922-PA...   321   4e-88
AY071138-1|AAL48760.1|  230|Drosophila melanogaster RE17836p pro...   314   9e-86
AE014297-1922|AAF55116.1|  230|Drosophila melanogaster CG7014-PA...   314   9e-86
L20297-1|AAA28860.1|  685|Drosophila melanogaster neurotrophic r...    31   1.4  
AE014134-1796|AAF52885.1|  685|Drosophila melanogaster CG4926-PA...    31   1.4  

>U48394-1|AAB61633.1|  228|Drosophila melanogaster M(1)15D protein.
          Length = 228

 Score =  321 bits (789), Expect = 4e-88
 Identities = 154/183 (84%), Positives = 168/183 (91%)
 Frame = +2

Query: 104 AEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGR 283
           AE    ++ET ++    ++PEIKLFGRWSC DV V+D+SLQDYISVKEK+A+YLPHSAGR
Sbjct: 21  AEVAETILET-NVVSTTELPEIKLFGRWSCDDVTVNDISLQDYISVKEKFARYLPHSAGR 79

Query: 284 YAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTA 463
           YA KRFRKAQCPIVERLT SLMM GRNNGKKLMA RIVKH+FEIIHLLTGENPLQ+LV+A
Sbjct: 80  YAAKRFRKAQCPIVERLTCSLMMKGRNNGKKLMACRIVKHSFEIIHLLTGENPLQILVSA 139

Query: 464 IINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVAD 643
           IINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAEC+AD
Sbjct: 140 IINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLAD 199

Query: 644 ELI 652
           ELI
Sbjct: 200 ELI 202


>AY075368-1|AAL68215.1|  228|Drosophila melanogaster GM13047p
           protein.
          Length = 228

 Score =  321 bits (789), Expect = 4e-88
 Identities = 154/183 (84%), Positives = 168/183 (91%)
 Frame = +2

Query: 104 AEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGR 283
           AE    ++ET ++    ++PEIKLFGRWSC DV V+D+SLQDYISVKEK+A+YLPHSAGR
Sbjct: 21  AEVAETILET-NVVSTTELPEIKLFGRWSCDDVTVNDISLQDYISVKEKFARYLPHSAGR 79

Query: 284 YAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTA 463
           YA KRFRKAQCPIVERLT SLMM GRNNGKKLMA RIVKH+FEIIHLLTGENPLQ+LV+A
Sbjct: 80  YAAKRFRKAQCPIVERLTCSLMMKGRNNGKKLMACRIVKHSFEIIHLLTGENPLQILVSA 139

Query: 464 IINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVAD 643
           IINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAEC+AD
Sbjct: 140 IINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLAD 199

Query: 644 ELI 652
           ELI
Sbjct: 200 ELI 202


>AE014298-2526|AAF48700.1|  228|Drosophila melanogaster CG8922-PA
           protein.
          Length = 228

 Score =  321 bits (789), Expect = 4e-88
 Identities = 154/183 (84%), Positives = 168/183 (91%)
 Frame = +2

Query: 104 AEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGR 283
           AE    ++ET ++    ++PEIKLFGRWSC DV V+D+SLQDYISVKEK+A+YLPHSAGR
Sbjct: 21  AEVAETILET-NVVSTTELPEIKLFGRWSCDDVTVNDISLQDYISVKEKFARYLPHSAGR 79

Query: 284 YAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTA 463
           YA KRFRKAQCPIVERLT SLMM GRNNGKKLMA RIVKH+FEIIHLLTGENPLQ+LV+A
Sbjct: 80  YAAKRFRKAQCPIVERLTCSLMMKGRNNGKKLMACRIVKHSFEIIHLLTGENPLQILVSA 139

Query: 464 IINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVAD 643
           IINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAEC+AD
Sbjct: 140 IINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLAD 199

Query: 644 ELI 652
           ELI
Sbjct: 200 ELI 202


>AY071138-1|AAL48760.1|  230|Drosophila melanogaster RE17836p
           protein.
          Length = 230

 Score =  314 bits (770), Expect = 9e-86
 Identities = 149/191 (78%), Positives = 167/191 (87%)
 Frame = +2

Query: 80  EENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAK 259
           +E+W DDV       V TM   +  + PEIKLFGRW+C D+ +SD+SLQDYI+VKEK+A+
Sbjct: 21  QEDWADDV-------VTTMPAQEVTEWPEIKLFGRWACDDISISDISLQDYIAVKEKFAR 73

Query: 260 YLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGEN 439
           YLPHSAGRYA KRFRKAQCPIVERLT+ LMM GR+NGKKL+A RIVKHAFEIIHLLT EN
Sbjct: 74  YLPHSAGRYAAKRFRKAQCPIVERLTSGLMMKGRSNGKKLLACRIVKHAFEIIHLLTSEN 133

Query: 440 PLQVLVTAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIK 619
           PLQV V AI+NSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWL+CTGAREAAFRNIK
Sbjct: 134 PLQVTVNAIVNSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLICTGAREAAFRNIK 193

Query: 620 TIAECVADELI 652
           T+AEC+ADELI
Sbjct: 194 TVAECLADELI 204


>AE014297-1922|AAF55116.1|  230|Drosophila melanogaster CG7014-PA
           protein.
          Length = 230

 Score =  314 bits (770), Expect = 9e-86
 Identities = 149/191 (78%), Positives = 167/191 (87%)
 Frame = +2

Query: 80  EENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAK 259
           +E+W DDV       V TM   +  + PEIKLFGRW+C D+ +SD+SLQDYI+VKEK+A+
Sbjct: 21  QEDWADDV-------VTTMPAQEVTEWPEIKLFGRWACDDISISDISLQDYIAVKEKFAR 73

Query: 260 YLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGEN 439
           YLPHSAGRYA KRFRKAQCPIVERLT+ LMM GR+NGKKL+A RIVKHAFEIIHLLT EN
Sbjct: 74  YLPHSAGRYAAKRFRKAQCPIVERLTSGLMMKGRSNGKKLLACRIVKHAFEIIHLLTSEN 133

Query: 440 PLQVLVTAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIK 619
           PLQV V AI+NSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWL+CTGAREAAFRNIK
Sbjct: 134 PLQVTVNAIVNSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLICTGAREAAFRNIK 193

Query: 620 TIAECVADELI 652
           T+AEC+ADELI
Sbjct: 194 TVAECLADELI 204


>L20297-1|AAA28860.1|  685|Drosophila melanogaster neurotrophic
           receptor protein.
          Length = 685

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = -2

Query: 262 IFCVLLFNGNVVLQRHIRDLHIVATPSAEKLDFRN 158
           IF ++LF    ++   +R++H + TPSA+K  + N
Sbjct: 332 IFAIILFKRRTIMHYGMRNIHNINTPSADKNIYGN 366


>AE014134-1796|AAF52885.1|  685|Drosophila melanogaster CG4926-PA
           protein.
          Length = 685

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 12/35 (34%), Positives = 22/35 (62%)
 Frame = -2

Query: 262 IFCVLLFNGNVVLQRHIRDLHIVATPSAEKLDFRN 158
           IF ++LF    ++   +R++H + TPSA+K  + N
Sbjct: 332 IFAIILFKRRTIMHYGMRNIHNINTPSADKNIYGN 366


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,893,511
Number of Sequences: 53049
Number of extensions: 640009
Number of successful extensions: 1611
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 1554
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1609
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2786177250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -