SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B03
         (549 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT001760-1|AAN71515.1|  159|Drosophila melanogaster RH06526p pro...   215   3e-56
AY071556-1|AAL49178.1|  159|Drosophila melanogaster RE62581p pro...   215   3e-56
AE014134-3588|AAF57259.1|  159|Drosophila melanogaster CG12775-P...   215   3e-56
AY875639-1|AAX59985.1| 1854|Drosophila melanogaster Dp205 protein.     30   1.8  
AE014297-2674|ABI31177.1| 1854|Drosophila melanogaster CG34157-P...    30   1.8  
U28966-1|AAB52512.1|  419|Drosophila melanogaster septin protein.      29   5.5  
AY061281-1|AAL28829.1|  419|Drosophila melanogaster LD20082p pro...    29   5.5  
AE014297-2823|AAF55783.1|  419|Drosophila melanogaster CG4173-PA...    29   5.5  
AF035251-1|AAC28563.1| 1354|Drosophila melanogaster tripeptidyl ...    28   7.2  
AE014298-789|AAN09151.2|  312|Drosophila melanogaster CG15771-PB...    28   7.2  
AE014298-788|AAF46077.4|  355|Drosophila melanogaster CG15771-PA...    28   7.2  
AE014297-110|AAF52119.1|  975|Drosophila melanogaster CG9783-PA ...    28   9.6  
AE014296-2825|AAS64979.1| 1431|Drosophila melanogaster CG33256-P...    28   9.6  

>BT001760-1|AAN71515.1|  159|Drosophila melanogaster RH06526p
           protein.
          Length = 159

 Score =  215 bits (525), Expect = 3e-56
 Identities = 92/130 (70%), Positives = 115/130 (88%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM+V+K+GDIVDI+G+GAVQKG+P+K YHGKTGR++NVT HA+GVIVNKRVRG+I+ KR+
Sbjct: 30  YMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIFNVTQHAVGVIVNKRVRGKILAKRV 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 484
           N+R+EH+ HSKCR+DFL+RVKENERLLKEAK  G+ V+LKRQP  PK AH V   E+P+ 
Sbjct: 90  NVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQWVSLKRQPEQPKKAHFVKKLEEPIA 149

Query: 485 LAPIPYEFVA 514
           LAPIPYEF+A
Sbjct: 150 LAPIPYEFIA 159



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = +3

Query: 36 MTNSKGYRRGTRXL 77
          MTNSKGYRRGTR +
Sbjct: 1  MTNSKGYRRGTRDM 14



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = +1

Query: 76  LFARRFRTHGTIPLST 123
           +F+R FR HG IPLST
Sbjct: 14  MFSRPFRKHGVIPLST 29


>AY071556-1|AAL49178.1|  159|Drosophila melanogaster RE62581p
           protein.
          Length = 159

 Score =  215 bits (525), Expect = 3e-56
 Identities = 92/130 (70%), Positives = 115/130 (88%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM+V+K+GDIVDI+G+GAVQKG+P+K YHGKTGR++NVT HA+GVIVNKRVRG+I+ KR+
Sbjct: 30  YMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIFNVTQHAVGVIVNKRVRGKILAKRV 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 484
           N+R+EH+ HSKCR+DFL+RVKENERLLKEAK  G+ V+LKRQP  PK AH V   E+P+ 
Sbjct: 90  NVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQWVSLKRQPEQPKKAHFVKKLEEPIA 149

Query: 485 LAPIPYEFVA 514
           LAPIPYEF+A
Sbjct: 150 LAPIPYEFIA 159



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = +3

Query: 36 MTNSKGYRRGTRXL 77
          MTNSKGYRRGTR +
Sbjct: 1  MTNSKGYRRGTRDM 14



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = +1

Query: 76  LFARRFRTHGTIPLST 123
           +F+R FR HG IPLST
Sbjct: 14  MFSRPFRKHGVIPLST 29


>AE014134-3588|AAF57259.1|  159|Drosophila melanogaster CG12775-PA
           protein.
          Length = 159

 Score =  215 bits (525), Expect = 3e-56
 Identities = 92/130 (70%), Positives = 115/130 (88%)
 Frame = +2

Query: 125 YMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRI 304
           YM+V+K+GDIVDI+G+GAVQKG+P+K YHGKTGR++NVT HA+GVIVNKRVRG+I+ KR+
Sbjct: 30  YMRVFKIGDIVDIKGHGAVQKGLPYKAYHGKTGRIFNVTQHAVGVIVNKRVRGKILAKRV 89

Query: 305 NIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVL 484
           N+R+EH+ HSKCR+DFL+RVKENERLLKEAK  G+ V+LKRQP  PK AH V   E+P+ 
Sbjct: 90  NVRIEHIHHSKCREDFLRRVKENERLLKEAKEKGQWVSLKRQPEQPKKAHFVKKLEEPIA 149

Query: 485 LAPIPYEFVA 514
           LAPIPYEF+A
Sbjct: 150 LAPIPYEFIA 159



 Score = 30.3 bits (65), Expect = 1.8
 Identities = 12/14 (85%), Positives = 13/14 (92%)
 Frame = +3

Query: 36 MTNSKGYRRGTRXL 77
          MTNSKGYRRGTR +
Sbjct: 1  MTNSKGYRRGTRDM 14



 Score = 28.3 bits (60), Expect = 7.2
 Identities = 11/16 (68%), Positives = 13/16 (81%)
 Frame = +1

Query: 76  LFARRFRTHGTIPLST 123
           +F+R FR HG IPLST
Sbjct: 14  MFSRPFRKHGVIPLST 29


>AY875639-1|AAX59985.1| 1854|Drosophila melanogaster Dp205 protein.
          Length = 1854

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +2

Query: 236 VTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKE 391
           V     G+   +R +  IIP   N ++E  +HS    +   ++ +N RL+ E
Sbjct: 612 VNGQTNGIPTRRRPKSSIIPSSSNGKLEQREHSLVTSESFHQISDNLRLMSE 663


>AE014297-2674|ABI31177.1| 1854|Drosophila melanogaster CG34157-PD,
           isoform D protein.
          Length = 1854

 Score = 30.3 bits (65), Expect = 1.8
 Identities = 14/52 (26%), Positives = 25/52 (48%)
 Frame = +2

Query: 236 VTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKE 391
           V     G+   +R +  IIP   N ++E  +HS    +   ++ +N RL+ E
Sbjct: 612 VNGQTNGIPTRRRPKSSIIPSSSNGKLEQREHSLVTSESFHQISDNLRLMSE 663


>U28966-1|AAB52512.1|  419|Drosophila melanogaster septin protein.
          Length = 419

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +2

Query: 296 KRINIRVE-HVKHSKCRQDFLKRVKENERLLKEAK--AAGKTVNLKRQPAPPK 445
           KR N   E   K  + RQ F++RVKE E  LKE++     K   LKR  A  K
Sbjct: 328 KRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEKDLHAKFEKLKRDHAEEK 380


>AY061281-1|AAL28829.1|  419|Drosophila melanogaster LD20082p
           protein.
          Length = 419

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +2

Query: 296 KRINIRVE-HVKHSKCRQDFLKRVKENERLLKEAK--AAGKTVNLKRQPAPPK 445
           KR N   E   K  + RQ F++RVKE E  LKE++     K   LKR  A  K
Sbjct: 328 KRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEKDLHAKFEKLKRDHAEEK 380


>AE014297-2823|AAF55783.1|  419|Drosophila melanogaster CG4173-PA
           protein.
          Length = 419

 Score = 28.7 bits (61), Expect = 5.5
 Identities = 22/53 (41%), Positives = 27/53 (50%), Gaps = 3/53 (5%)
 Frame = +2

Query: 296 KRINIRVE-HVKHSKCRQDFLKRVKENERLLKEAK--AAGKTVNLKRQPAPPK 445
           KR N   E   K  + RQ F++RVKE E  LKE++     K   LKR  A  K
Sbjct: 328 KRSNHLAELQSKEEEVRQMFVQRVKEKEAELKESEKDLHAKFEKLKRDHAEEK 380


>AF035251-1|AAC28563.1| 1354|Drosophila melanogaster tripeptidyl
            peptidase II protein.
          Length = 1354

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 15/46 (32%), Positives = 23/46 (50%)
 Frame = +2

Query: 155  VDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRII 292
            VD   + A+Q G+ H   HG  GR+Y    + + +I  KR R   +
Sbjct: 1279 VDANDSKAIQFGLWHAYAHGHYGRMYK---YVVKLIEEKRTRDHFV 1321


>AE014298-789|AAN09151.2|  312|Drosophila melanogaster CG15771-PB,
           isoform B protein.
          Length = 312

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = +1

Query: 130 ESVQSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSC 249
           E  Q   H  HQRQW   +G    S+P  D S  + + SC
Sbjct: 272 EQQQQHHHHHHQRQWLYRRGV---SLPAMDCSNSEAENSC 308


>AE014298-788|AAF46077.4|  355|Drosophila melanogaster CG15771-PA,
           isoform A protein.
          Length = 355

 Score = 28.3 bits (60), Expect = 7.2
 Identities = 15/40 (37%), Positives = 19/40 (47%)
 Frame = +1

Query: 130 ESVQSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSC 249
           E  Q   H  HQRQW   +G    S+P  D S  + + SC
Sbjct: 315 EQQQQHHHHHHQRQWLYRRGV---SLPAMDCSNSEAENSC 351


>AE014297-110|AAF52119.1|  975|Drosophila melanogaster CG9783-PA
           protein.
          Length = 975

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 13/40 (32%), Positives = 20/40 (50%)
 Frame = +2

Query: 359 RVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKP 478
           R   N    + +  AG++V +K +  PP  A + SGT  P
Sbjct: 615 RTSTNPSSSQSSSLAGESVEVKVEITPPTNADLASGTNLP 654


>AE014296-2825|AAS64979.1| 1431|Drosophila melanogaster CG33256-PA
           protein.
          Length = 1431

 Score = 27.9 bits (59), Expect = 9.6
 Identities = 12/25 (48%), Positives = 15/25 (60%)
 Frame = +3

Query: 435 LPLKLPTSSVELRNPSYLRLSHTNS 509
           LPL LPT S+E+  P     SHT +
Sbjct: 339 LPLPLPTISIEIAEPPEENASHTEA 363


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 24,625,107
Number of Sequences: 53049
Number of extensions: 520792
Number of successful extensions: 1716
Number of sequences better than 10.0: 13
Number of HSP's better than 10.0 without gapping: 1662
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1716
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2089831299
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -