SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_B02
         (347 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY075533-1|AAL68340.2|   68|Drosophila melanogaster RH06643p pro...    83   9e-17
AE014297-1040|AAF54450.1|   56|Drosophila melanogaster CG8495-PA...    83   9e-17
BT001305-1|AAN71060.1|   43|Drosophila melanogaster AT13329p pro...    79   1e-15
AE014297-1041|AAN13446.1|   55|Drosophila melanogaster CG8495-PC...    79   1e-15
AY060673-1|AAL28221.3|  446|Drosophila melanogaster GH10523p pro...    27   4.9  
AE014297-1276|AAF54621.2|  446|Drosophila melanogaster CG31388-P...    27   4.9  
BT025854-1|ABF85754.1| 1031|Drosophila melanogaster IP15264p pro...    27   6.5  
AF145617-1|AAD38592.1|  594|Drosophila melanogaster BcDNA.GH0352...    27   6.5  
AE014296-337|AAF47553.2|  881|Drosophila melanogaster CG2086-PB,...    27   6.5  
AE014296-336|AAF47552.1|  594|Drosophila melanogaster CG2086-PA,...    27   6.5  
AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P...    27   6.5  

>AY075533-1|AAL68340.2|   68|Drosophila melanogaster RH06643p
           protein.
          Length = 68

 Score = 83.0 bits (196), Expect = 9e-17
 Identities = 34/36 (94%), Positives = 36/36 (100%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           CR+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD
Sbjct: 33  CRACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 68



 Score = 41.5 bits (93), Expect = 3e-04
 Identities = 15/19 (78%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MG A +WYSHPR+YGQGSR
Sbjct: 13  MGFATLWYSHPRKYGQGSR 31


>AE014297-1040|AAF54450.1|   56|Drosophila melanogaster CG8495-PA,
           isoform A protein.
          Length = 56

 Score = 83.0 bits (196), Expect = 9e-17
 Identities = 34/36 (94%), Positives = 36/36 (100%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           CR+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD
Sbjct: 21  CRACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 56



 Score = 41.5 bits (93), Expect = 3e-04
 Identities = 15/19 (78%), Positives = 17/19 (89%)
 Frame = +1

Query: 82  MGHANIWYSHPRRYGQGSR 138
           MG A +WYSHPR+YGQGSR
Sbjct: 1   MGFATLWYSHPRKYGQGSR 19


>BT001305-1|AAN71060.1|   43|Drosophila melanogaster AT13329p
           protein.
          Length = 43

 Score = 79.4 bits (187), Expect = 1e-15
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 146 RSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           R+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD
Sbjct: 9   RACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 43


>AE014297-1041|AAN13446.1|   55|Drosophila melanogaster CG8495-PC,
           isoform C protein.
          Length = 55

 Score = 79.4 bits (187), Expect = 1e-15
 Identities = 33/35 (94%), Positives = 35/35 (100%)
 Frame = +2

Query: 146 RSCSNRHGLIRKYGLNICRQCFREYAHDIGFKKLD 250
           R+CSNRHGLIRKYGLNICRQCFREYA+DIGFKKLD
Sbjct: 21  RACSNRHGLIRKYGLNICRQCFREYANDIGFKKLD 55


>AY060673-1|AAL28221.3|  446|Drosophila melanogaster GH10523p
           protein.
          Length = 446

 Score = 27.5 bits (58), Expect = 4.9
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAH 226
           CR+    H L R +G  ICR  F+   H
Sbjct: 386 CRTHQKYHNLTRDHGCEICRISFKTAKH 413


>AE014297-1276|AAF54621.2|  446|Drosophila melanogaster CG31388-PA
           protein.
          Length = 446

 Score = 27.5 bits (58), Expect = 4.9
 Identities = 11/28 (39%), Positives = 14/28 (50%)
 Frame = +2

Query: 143 CRSCSNRHGLIRKYGLNICRQCFREYAH 226
           CR+    H L R +G  ICR  F+   H
Sbjct: 386 CRTHQKYHNLTRDHGCEICRISFKTAKH 413


>BT025854-1|ABF85754.1| 1031|Drosophila melanogaster IP15264p
           protein.
          Length = 1031

 Score = 27.1 bits (57), Expect = 6.5
 Identities = 12/36 (33%), Positives = 16/36 (44%)
 Frame = -1

Query: 224 EHTL*STVCICSNRTCGLSHACWSRIGMXRDPCPYL 117
           EH + +  C  +N  C  +H C  R G   D C  L
Sbjct: 748 EHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDEL 783


>AF145617-1|AAD38592.1|  594|Drosophila melanogaster BcDNA.GH03529
           protein.
          Length = 594

 Score = 27.1 bits (57), Expect = 6.5
 Identities = 12/36 (33%), Positives = 16/36 (44%)
 Frame = -1

Query: 224 EHTL*STVCICSNRTCGLSHACWSRIGMXRDPCPYL 117
           EH + +  C  +N  C  +H C  R G   D C  L
Sbjct: 300 EHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDEL 335


>AE014296-337|AAF47553.2|  881|Drosophila melanogaster CG2086-PB,
           isoform B protein.
          Length = 881

 Score = 27.1 bits (57), Expect = 6.5
 Identities = 12/36 (33%), Positives = 16/36 (44%)
 Frame = -1

Query: 224 EHTL*STVCICSNRTCGLSHACWSRIGMXRDPCPYL 117
           EH + +  C  +N  C  +H C  R G   D C  L
Sbjct: 587 EHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDEL 622


>AE014296-336|AAF47552.1|  594|Drosophila melanogaster CG2086-PA,
           isoform A protein.
          Length = 594

 Score = 27.1 bits (57), Expect = 6.5
 Identities = 12/36 (33%), Positives = 16/36 (44%)
 Frame = -1

Query: 224 EHTL*STVCICSNRTCGLSHACWSRIGMXRDPCPYL 117
           EH + +  C  +N  C  +H C  R G   D C  L
Sbjct: 300 EHCMNTCACPSANFQCHAAHGCVCRSGYTGDNCDEL 335


>AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB
            protein.
          Length = 23015

 Score = 27.1 bits (57), Expect = 6.5
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = -1

Query: 194  CSNRTCGLSHACWSRIG 144
            C+N+ CGL+ AC +R G
Sbjct: 1437 CANKPCGLNAACLNRAG 1453


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,754,622
Number of Sequences: 53049
Number of extensions: 227044
Number of successful extensions: 611
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 584
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 611
length of database: 24,988,368
effective HSP length: 76
effective length of database: 20,956,644
effective search space used: 817309116
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -