SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A24
         (653 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X82257-1|CAA57712.1|  136|Drosophila melanogaster histone H3.3A ...   109   2e-24
X81207-2|CAA57080.1|  136|Drosophila melanogaster histone H3.3 p...   109   2e-24
X81205-1|CAA57077.1|  136|Drosophila melanogaster histone H3.3 p...   109   2e-24
X53822-1|CAA37819.1|  136|Drosophila melanogaster Histone H3.3Q ...   109   2e-24
AY119629-1|AAM50283.1|  136|Drosophila melanogaster RE21618p pro...   109   2e-24
AY118325-1|AAM48354.1|  136|Drosophila melanogaster LD17717p pro...   109   2e-24
AY071057-1|AAL48679.1|  136|Drosophila melanogaster RE14004p pro...   109   2e-24
AE014298-1288|AAO41645.1|  136|Drosophila melanogaster CG8989-PC...   109   2e-24
AE014298-1287|AAN09245.1|  136|Drosophila melanogaster CG8989-PB...   109   2e-24
AE014298-1286|AAF46452.1|  136|Drosophila melanogaster CG8989-PA...   109   2e-24
AE014134-867|AAF52213.1|  136|Drosophila melanogaster CG5825-PA,...   109   2e-24
AE014134-866|AAN10526.1|  123|Drosophila melanogaster CG5825-PB,...   109   2e-24
AY383571-1|AAQ96278.1|  107|Drosophila melanogaster H3L-like his...   109   3e-24
X14215-4|CAA32434.1|  136|Drosophila melanogaster H3 histone pro...   104   9e-23
AE014134-3510|AAZ66583.1|  136|Drosophila melanogaster CG33866-P...   104   9e-23
AE014134-3506|AAZ66579.1|  136|Drosophila melanogaster CG33863-P...   104   9e-23
AE014134-3501|AAZ66574.1|  136|Drosophila melanogaster CG33860-P...   104   9e-23
AE014134-3496|AAZ66569.1|  136|Drosophila melanogaster CG33857-P...   104   9e-23
AE014134-3491|AAZ66564.1|  136|Drosophila melanogaster CG33854-P...   104   9e-23
AE014134-3486|AAZ66559.1|  136|Drosophila melanogaster CG33851-P...   104   9e-23
AE014134-3481|AAZ66554.1|  136|Drosophila melanogaster CG33848-P...   104   9e-23
AE014134-3476|AAZ66549.1|  136|Drosophila melanogaster CG33845-P...   104   9e-23
AE014134-3471|AAZ66544.1|  136|Drosophila melanogaster CG33842-P...   104   9e-23
AE014134-3466|AAZ66539.1|  136|Drosophila melanogaster CG33839-P...   104   9e-23
AE014134-3461|AAZ66534.1|  136|Drosophila melanogaster CG33836-P...   104   9e-23
AE014134-3456|AAZ66529.1|  136|Drosophila melanogaster CG33833-P...   104   9e-23
AE014134-3451|AAZ66524.1|  136|Drosophila melanogaster CG33830-P...   104   9e-23
AE014134-3446|AAZ66519.1|  136|Drosophila melanogaster CG33827-P...   104   9e-23
AE014134-3441|AAZ66514.1|  136|Drosophila melanogaster CG33824-P...   104   9e-23
AE014134-3436|AAZ66509.1|  136|Drosophila melanogaster CG33821-P...   104   9e-23
AE014134-3431|AAZ66504.1|  136|Drosophila melanogaster CG33818-P...   104   9e-23
AE014134-3426|AAZ66499.1|  136|Drosophila melanogaster CG33815-P...   104   9e-23
AE014134-3421|AAZ66494.1|  136|Drosophila melanogaster CG33812-P...   104   9e-23
AE014134-3417|AAZ66490.1|  136|Drosophila melanogaster CG33809-P...   104   9e-23
AE014134-3412|AAZ66485.1|  136|Drosophila melanogaster CG33806-P...   104   9e-23
AE014134-3408|AAN11127.1|  136|Drosophila melanogaster CG31613-P...   104   9e-23
AE014134-3403|AAZ66481.1|  136|Drosophila melanogaster CG33803-P...   104   9e-23
AB019400-1|BAA93621.1|  136|Drosophila melanogaster histone H3 p...   104   9e-23
AY128465-1|AAM75058.1|  254|Drosophila melanogaster RE21270p pro...    44   2e-04
AY126933-1|AAM80991.1|  225|Drosophila melanogaster centromeric ...    44   2e-04
AY126931-1|AAM80989.1|  225|Drosophila melanogaster centromeric ...    44   2e-04
AY126930-1|AAM80988.1|  225|Drosophila melanogaster centromeric ...    44   2e-04
AY126929-1|AAM80987.1|  225|Drosophila melanogaster centromeric ...    44   2e-04
AF259371-1|AAF72652.1|  225|Drosophila melanogaster centromeric ...    44   2e-04
AE013599-1721|AAF58371.2|  225|Drosophila melanogaster CG13329-P...    44   2e-04
AY126932-1|AAM80990.1|  225|Drosophila melanogaster centromeric ...    41   0.001
AY122069-1|AAM52581.1|  407|Drosophila melanogaster AT12644p pro...    31   1.8  
AE014296-2020|AAN12241.2|  407|Drosophila melanogaster CG32087-P...    31   1.8  
AY069617-1|AAL39762.1|  787|Drosophila melanogaster LD38414p pro...    29   4.2  
AY052100-1|AAK93524.1|  757|Drosophila melanogaster SD04906p pro...    29   4.2  
AY051883-1|AAK93307.1|  308|Drosophila melanogaster LD37276p pro...    29   4.2  
AE014298-264|AAN09060.1|  742|Drosophila melanogaster CG14801-PD...    29   4.2  
AE014298-263|AAF45671.2|  761|Drosophila melanogaster CG14801-PC...    29   4.2  
AE014298-262|AAF45670.2|  761|Drosophila melanogaster CG14801-PA...    29   4.2  
AE014298-261|AAF45669.2|  787|Drosophila melanogaster CG14801-PB...    29   4.2  
AE014297-4096|AAF56683.1|  308|Drosophila melanogaster CG18766-P...    29   4.2  
AE014297-4095|AAG22171.2|  308|Drosophila melanogaster CG18766-P...    29   4.2  
AY094724-1|AAM11077.1|  788|Drosophila melanogaster GH21171p pro...    29   5.5  
AE014134-3368|AAF53983.2| 2759|Drosophila melanogaster CG8677-PA...    29   5.5  
BT023492-1|AAY84892.1|  405|Drosophila melanogaster RE20268p pro...    29   7.3  
AY113652-1|AAM29657.1|  918|Drosophila melanogaster SD14970p pro...    29   7.3  
AE014297-355|AAF51953.1|  405|Drosophila melanogaster CG2051-PB,...    29   7.3  
AE014297-354|AAN14322.1|  405|Drosophila melanogaster CG2051-PA,...    29   7.3  
AE014296-1695|AAF50237.1|  918|Drosophila melanogaster CG3335-PA...    29   7.3  

>X82257-1|CAA57712.1|  136|Drosophila melanogaster histone H3.3A
           variant protein.
          Length = 136

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>X81207-2|CAA57080.1|  136|Drosophila melanogaster histone H3.3
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>X81205-1|CAA57077.1|  136|Drosophila melanogaster histone H3.3
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>X53822-1|CAA37819.1|  136|Drosophila melanogaster Histone H3.3Q
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AY119629-1|AAM50283.1|  136|Drosophila melanogaster RE21618p
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AY118325-1|AAM48354.1|  136|Drosophila melanogaster LD17717p
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AY071057-1|AAL48679.1|  136|Drosophila melanogaster RE14004p
           protein.
          Length = 136

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014298-1288|AAO41645.1|  136|Drosophila melanogaster CG8989-PC,
           isoform C protein.
          Length = 136

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014298-1287|AAN09245.1|  136|Drosophila melanogaster CG8989-PB,
           isoform B protein.
          Length = 136

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014298-1286|AAF46452.1|  136|Drosophila melanogaster CG8989-PA,
           isoform A protein.
          Length = 136

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-867|AAF52213.1|  136|Drosophila melanogaster CG5825-PA,
           isoform A protein.
          Length = 136

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-866|AAN10526.1|  123|Drosophila melanogaster CG5825-PB,
           isoform B protein.
          Length = 123

 Score =  109 bits (263), Expect = 2e-24
 Identities = 56/59 (94%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 104



 Score = 97.1 bits (231), Expect = 2e-20
 Identities = 45/45 (100%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 45


>AY383571-1|AAQ96278.1|  107|Drosophila melanogaster H3L-like
           histone protein.
          Length = 107

 Score =  109 bits (262), Expect = 3e-24
 Identities = 55/59 (93%), Positives = 56/59 (94%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELL+RKLPFQRLVREIAQDFKTDL FQSAAIGALQEASEAYL  L
Sbjct: 31  TVALREIRRYQKSTELLVRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGL 89



 Score = 67.3 bits (157), Expect = 2e-11
 Identities = 30/30 (100%), Positives = 30/30 (100%)
 Frame = +3

Query: 168 APRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           APRKQLATKAARKSAPSTGGVKKPHRYRPG
Sbjct: 1   APRKQLATKAARKSAPSTGGVKKPHRYRPG 30



 Score = 46.8 bits (106), Expect = 3e-05
 Identities = 20/20 (100%), Positives = 20/20 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMP 490
           GLFEDTNLCAIHAKRVTIMP
Sbjct: 88  GLFEDTNLCAIHAKRVTIMP 107


>X14215-4|CAA32434.1|  136|Drosophila melanogaster H3 histone
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.3 bits (172), Expect = 3e-13
 Identities = 33/34 (97%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKR+TIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRITIMPKDIQLARRIRGERA 136


>AE014134-3510|AAZ66583.1|  136|Drosophila melanogaster CG33866-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3506|AAZ66579.1|  136|Drosophila melanogaster CG33863-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3501|AAZ66574.1|  136|Drosophila melanogaster CG33860-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3496|AAZ66569.1|  136|Drosophila melanogaster CG33857-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3491|AAZ66564.1|  136|Drosophila melanogaster CG33854-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3486|AAZ66559.1|  136|Drosophila melanogaster CG33851-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3481|AAZ66554.1|  136|Drosophila melanogaster CG33848-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3476|AAZ66549.1|  136|Drosophila melanogaster CG33845-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3471|AAZ66544.1|  136|Drosophila melanogaster CG33842-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3466|AAZ66539.1|  136|Drosophila melanogaster CG33839-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3461|AAZ66534.1|  136|Drosophila melanogaster CG33836-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3456|AAZ66529.1|  136|Drosophila melanogaster CG33833-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3451|AAZ66524.1|  136|Drosophila melanogaster CG33830-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3446|AAZ66519.1|  136|Drosophila melanogaster CG33827-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3441|AAZ66514.1|  136|Drosophila melanogaster CG33824-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3436|AAZ66509.1|  136|Drosophila melanogaster CG33821-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3431|AAZ66504.1|  136|Drosophila melanogaster CG33818-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3426|AAZ66499.1|  136|Drosophila melanogaster CG33815-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3421|AAZ66494.1|  136|Drosophila melanogaster CG33812-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3417|AAZ66490.1|  136|Drosophila melanogaster CG33809-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3412|AAZ66485.1|  136|Drosophila melanogaster CG33806-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3408|AAN11127.1|  136|Drosophila melanogaster CG31613-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AE014134-3403|AAZ66481.1|  136|Drosophila melanogaster CG33803-PA
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AB019400-1|BAA93621.1|  136|Drosophila melanogaster histone H3
           protein.
          Length = 136

 Score =  104 bits (250), Expect = 9e-23
 Identities = 53/59 (89%), Positives = 55/59 (93%)
 Frame = +1

Query: 259 TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWL 435
           TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDL FQS+A+ ALQEASEAYL  L
Sbjct: 46  TVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGL 104



 Score = 95.9 bits (228), Expect = 4e-20
 Identities = 44/45 (97%), Positives = 45/45 (100%)
 Frame = +3

Query: 123 MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPG 257
           MARTKQTARKSTGGKAPRKQLATKAARKSAP+TGGVKKPHRYRPG
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPG 45



 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 34/34 (100%), Positives = 34/34 (100%)
 Frame = +2

Query: 431 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 532
           GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 103 GLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136


>AY128465-1|AAM75058.1|  254|Drosophila melanogaster RE21270p
           protein.
          Length = 254

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKTD--LXFQSAAIGALQEASEAYL 426
           REIRR Q     LI KLPF RLVRE    +  D  L     A+ A+QE+ E YL
Sbjct: 164 REIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYL 217


>AY126933-1|AAM80991.1|  225|Drosophila melanogaster centromeric
           histone H3-like proteinCid protein.
          Length = 225

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKTD--LXFQSAAIGALQEASEAYL 426
           REIRR Q     LI KLPF RLVRE    +  D  L     A+ A+QE+ E YL
Sbjct: 135 REIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYL 188


>AY126931-1|AAM80989.1|  225|Drosophila melanogaster centromeric
           histone H3-like proteinCid protein.
          Length = 225

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKTD--LXFQSAAIGALQEASEAYL 426
           REIRR Q     LI KLPF RLVRE    +  D  L     A+ A+QE+ E YL
Sbjct: 135 REIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYL 188


>AY126930-1|AAM80988.1|  225|Drosophila melanogaster centromeric
           histone H3-like proteinCid protein.
          Length = 225

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKTD--LXFQSAAIGALQEASEAYL 426
           REIRR Q     LI KLPF RLVRE    +  D  L     A+ A+QE+ E YL
Sbjct: 135 REIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYL 188


>AY126929-1|AAM80987.1|  225|Drosophila melanogaster centromeric
           histone H3-like proteinCid protein.
          Length = 225

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKTD--LXFQSAAIGALQEASEAYL 426
           REIRR Q     LI KLPF RLVRE    +  D  L     A+ A+QE+ E YL
Sbjct: 135 REIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYL 188


>AF259371-1|AAF72652.1|  225|Drosophila melanogaster centromeric
           histone H3-like proteinCid protein.
          Length = 225

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKTD--LXFQSAAIGALQEASEAYL 426
           REIRR Q     LI KLPF RLVRE    +  D  L     A+ A+QE+ E YL
Sbjct: 135 REIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYL 188


>AE013599-1721|AAF58371.2|  225|Drosophila melanogaster CG13329-PA
           protein.
          Length = 225

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/54 (48%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKTD--LXFQSAAIGALQEASEAYL 426
           REIRR Q     LI KLPF RLVRE    +  D  L     A+ A+QE+ E YL
Sbjct: 135 REIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYL 188


>AY126932-1|AAM80990.1|  225|Drosophila melanogaster centromeric
           histone H3-like proteinCid protein.
          Length = 225

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 25/54 (46%), Positives = 29/54 (53%), Gaps = 2/54 (3%)
 Frame = +1

Query: 271 REIRRYQKSTELLIRKLPFQRLVREIAQDFKTD--LXFQSAAIGALQEASEAYL 426
           REIRR Q     LI KLPF RLVRE    +  D  L     A+ A+ E+ E YL
Sbjct: 135 REIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMXESCEMYL 188


>AY122069-1|AAM52581.1|  407|Drosophila melanogaster AT12644p
           protein.
          Length = 407

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/52 (34%), Positives = 25/52 (48%)
 Frame = +1

Query: 322 PFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLVRRHQLVCYSRQTC 477
           P QR++RE+ Q  K  +       G +   S AYL  LVR  +L  +   TC
Sbjct: 317 PMQRMIRELLQSTKQQMH------GTVNSNSLAYLSHLVRAFELCAFIMVTC 362


>AE014296-2020|AAN12241.2|  407|Drosophila melanogaster CG32087-PA
           protein.
          Length = 407

 Score = 30.7 bits (66), Expect = 1.8
 Identities = 18/52 (34%), Positives = 25/52 (48%)
 Frame = +1

Query: 322 PFQRLVREIAQDFKTDLXFQSAAIGALQEASEAYLXWLVRRHQLVCYSRQTC 477
           P QR++RE+ Q  K  +       G +   S AYL  LVR  +L  +   TC
Sbjct: 317 PMQRMIRELLQSTKQQMH------GTVNSNSLAYLSHLVRAFELCAFIMVTC 362


>AY069617-1|AAL39762.1|  787|Drosophila melanogaster LD38414p
           protein.
          Length = 787

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = -2

Query: 577 SYRITSNQNYN*TNLSTFTTDSSSKLNILRHDGHTFGVNSTQVGVFEQA 431
           S RIT+  N N T  S  + +SS+K    ++ G+T  VNS  +   +QA
Sbjct: 54  SSRITTTNN-NVTTTSNISGNSSNKRCPQKYTGNTLAVNSNMLAYQQQA 101


>AY052100-1|AAK93524.1|  757|Drosophila melanogaster SD04906p
           protein.
          Length = 757

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = -2

Query: 577 SYRITSNQNYN*TNLSTFTTDSSSKLNILRHDGHTFGVNSTQVGVFEQA 431
           S RIT+  N N T  S  + +SS+K    ++ G+T  VNS  +   +QA
Sbjct: 28  SSRITTTNN-NVTTTSNISGNSSNKRCPQKYTGNTLAVNSNMLAYQQQA 75


>AY051883-1|AAK93307.1|  308|Drosophila melanogaster LD37276p
           protein.
          Length = 308

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = +1

Query: 142 LPVNLLEVKLRVNNLLQKRRENQR 213
           +PV  LEV  +VNNL Q+ R+ Q+
Sbjct: 54  VPVTALEVHFKVNNLTQRYRQEQK 77


>AE014298-264|AAN09060.1|  742|Drosophila melanogaster CG14801-PD,
           isoform D protein.
          Length = 742

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = -2

Query: 577 SYRITSNQNYN*TNLSTFTTDSSSKLNILRHDGHTFGVNSTQVGVFEQA 431
           S RIT+  N N T  S  + +SS+K    ++ G+T  VNS  +   +QA
Sbjct: 9   SSRITTTNN-NVTTTSNISGNSSNKRCPQKYTGNTLAVNSNMLAYQQQA 56


>AE014298-263|AAF45671.2|  761|Drosophila melanogaster CG14801-PC,
           isoform C protein.
          Length = 761

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = -2

Query: 577 SYRITSNQNYN*TNLSTFTTDSSSKLNILRHDGHTFGVNSTQVGVFEQA 431
           S RIT+  N N T  S  + +SS+K    ++ G+T  VNS  +   +QA
Sbjct: 28  SSRITTTNN-NVTTTSNISGNSSNKRCPQKYTGNTLAVNSNMLAYQQQA 75


>AE014298-262|AAF45670.2|  761|Drosophila melanogaster CG14801-PA,
           isoform A protein.
          Length = 761

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = -2

Query: 577 SYRITSNQNYN*TNLSTFTTDSSSKLNILRHDGHTFGVNSTQVGVFEQA 431
           S RIT+  N N T  S  + +SS+K    ++ G+T  VNS  +   +QA
Sbjct: 28  SSRITTTNN-NVTTTSNISGNSSNKRCPQKYTGNTLAVNSNMLAYQQQA 75


>AE014298-261|AAF45669.2|  787|Drosophila melanogaster CG14801-PB,
           isoform B protein.
          Length = 787

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 18/49 (36%), Positives = 27/49 (55%)
 Frame = -2

Query: 577 SYRITSNQNYN*TNLSTFTTDSSSKLNILRHDGHTFGVNSTQVGVFEQA 431
           S RIT+  N N T  S  + +SS+K    ++ G+T  VNS  +   +QA
Sbjct: 54  SSRITTTNN-NVTTTSNISGNSSNKRCPQKYTGNTLAVNSNMLAYQQQA 101


>AE014297-4096|AAF56683.1|  308|Drosophila melanogaster CG18766-PB,
           isoform B protein.
          Length = 308

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = +1

Query: 142 LPVNLLEVKLRVNNLLQKRRENQR 213
           +PV  LEV  +VNNL Q+ R+ Q+
Sbjct: 54  VPVTALEVHFKVNNLTQRYRQEQK 77


>AE014297-4095|AAG22171.2|  308|Drosophila melanogaster CG18766-PA,
           isoform A protein.
          Length = 308

 Score = 29.5 bits (63), Expect = 4.2
 Identities = 12/24 (50%), Positives = 17/24 (70%)
 Frame = +1

Query: 142 LPVNLLEVKLRVNNLLQKRRENQR 213
           +PV  LEV  +VNNL Q+ R+ Q+
Sbjct: 54  VPVTALEVHFKVNNLTQRYRQEQK 77


>AY094724-1|AAM11077.1|  788|Drosophila melanogaster GH21171p
           protein.
          Length = 788

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +3

Query: 165 KAPRKQLATKAARKSAPSTGGVKKPHRYR 251
           K   + +    A+ SAPST G+++PHR R
Sbjct: 130 KQTSRVMPESPAQNSAPSTSGLQEPHRKR 158


>AE014134-3368|AAF53983.2| 2759|Drosophila melanogaster CG8677-PA
            protein.
          Length = 2759

 Score = 29.1 bits (62), Expect = 5.5
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +3

Query: 165  KAPRKQLATKAARKSAPSTGGVKKPHRYR 251
            K   + +    A+ SAPST G+++PHR R
Sbjct: 2101 KQTSRVMPESPAQNSAPSTSGLQEPHRKR 2129


>BT023492-1|AAY84892.1|  405|Drosophila melanogaster RE20268p
           protein.
          Length = 405

 Score = 28.7 bits (61), Expect = 7.3
 Identities = 20/87 (22%), Positives = 46/87 (52%), Gaps = 3/87 (3%)
 Frame = +1

Query: 112 KSKQWLVLNKLPVNLLEVKLRV--NNLLQKRRENQRRALVESRSHIVIALXTVALREIRR 285
           ++++ L LN L V  +   LR+   N+  ++     R  V+ R + V       L+++ R
Sbjct: 303 EAREALKLNPLQVRKVYELLRLFYTNVKDEKEYRPYRLEVKKRLNAVYYKQLKDLKKMER 362

Query: 286 YQKSTELLIRKLP-FQRLVREIAQDFK 363
           ++  TE+L  +LP  Q+ + ++ ++++
Sbjct: 363 FKMDTEMLRARLPTVQQRMEQLHEEYR 389


>AY113652-1|AAM29657.1|  918|Drosophila melanogaster SD14970p
           protein.
          Length = 918

 Score = 28.7 bits (61), Expect = 7.3
 Identities = 11/28 (39%), Positives = 18/28 (64%)
 Frame = +1

Query: 280 RRYQKSTELLIRKLPFQRLVREIAQDFK 363
           ++ Q  T++L+R +PFQ   RE+   FK
Sbjct: 779 QKKQTGTKILVRNIPFQAQYREVRDIFK 806


>AE014297-355|AAF51953.1|  405|Drosophila melanogaster CG2051-PB,
           isoform B protein.
          Length = 405

 Score = 28.7 bits (61), Expect = 7.3
 Identities = 20/87 (22%), Positives = 46/87 (52%), Gaps = 3/87 (3%)
 Frame = +1

Query: 112 KSKQWLVLNKLPVNLLEVKLRV--NNLLQKRRENQRRALVESRSHIVIALXTVALREIRR 285
           ++++ L LN L V  +   LR+   N+  ++     R  V+ R + V       L+++ R
Sbjct: 303 EAREALKLNPLQVRKVYELLRLFYTNVKDEKEYRPYRLEVKKRLNAVYYKQLKDLKKMER 362

Query: 286 YQKSTELLIRKLP-FQRLVREIAQDFK 363
           ++  TE+L  +LP  Q+ + ++ ++++
Sbjct: 363 FKMDTEMLRARLPTVQQRMEQLHEEYR 389


>AE014297-354|AAN14322.1|  405|Drosophila melanogaster CG2051-PA,
           isoform A protein.
          Length = 405

 Score = 28.7 bits (61), Expect = 7.3
 Identities = 20/87 (22%), Positives = 46/87 (52%), Gaps = 3/87 (3%)
 Frame = +1

Query: 112 KSKQWLVLNKLPVNLLEVKLRV--NNLLQKRRENQRRALVESRSHIVIALXTVALREIRR 285
           ++++ L LN L V  +   LR+   N+  ++     R  V+ R + V       L+++ R
Sbjct: 303 EAREALKLNPLQVRKVYELLRLFYTNVKDEKEYRPYRLEVKKRLNAVYYKQLKDLKKMER 362

Query: 286 YQKSTELLIRKLP-FQRLVREIAQDFK 363
           ++  TE+L  +LP  Q+ + ++ ++++
Sbjct: 363 FKMDTEMLRARLPTVQQRMEQLHEEYR 389


>AE014296-1695|AAF50237.1|  918|Drosophila melanogaster CG3335-PA
           protein.
          Length = 918

 Score = 28.7 bits (61), Expect = 7.3
 Identities = 11/28 (39%), Positives = 18/28 (64%)
 Frame = +1

Query: 280 RRYQKSTELLIRKLPFQRLVREIAQDFK 363
           ++ Q  T++L+R +PFQ   RE+   FK
Sbjct: 779 QKKQTGTKILVRNIPFQAQYREVRDIFK 806


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,866,548
Number of Sequences: 53049
Number of extensions: 427187
Number of successful extensions: 1126
Number of sequences better than 10.0: 64
Number of HSP's better than 10.0 without gapping: 1015
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1124
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2786177250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -