SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A23
         (527 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X73153-1|CAA51677.1|  156|Drosophila melanogaster ribosomal prot...   132   3e-31
AY118868-1|AAM50728.1|  156|Drosophila melanogaster GM26647p pro...   132   3e-31
AF216206-1|AAF65682.1|  156|Drosophila melanogaster ribosomal pr...   132   3e-31
AE014298-2436|AAN09413.1|  156|Drosophila melanogaster CG4464-PC...   132   3e-31
AE014298-2435|AAN09412.1|  156|Drosophila melanogaster CG4464-PB...   132   3e-31
AE014298-2434|AAF48633.1|  156|Drosophila melanogaster CG4464-PA...   132   3e-31
AY119257-1|AAM51117.1|  155|Drosophila melanogaster SD22440p pro...   121   5e-28
AE014297-3411|AAN13960.1|  155|Drosophila melanogaster CG5338-PB...   121   5e-28
AJ271740-1|CAB93524.1| 16215|Drosophila melanogaster D-Titin pro...    28   6.8  
AE014296-405|AAG22226.2| 18074|Drosophila melanogaster CG1915-PC...    28   6.8  
AY061282-1|AAL28830.1|  378|Drosophila melanogaster LD20087p pro...    28   9.0  
AE014134-264|AAF51367.2|  378|Drosophila melanogaster CG7420-PA ...    28   9.0  

>X73153-1|CAA51677.1|  156|Drosophila melanogaster ribosomal protein
           S19 protein.
          Length = 156

 Score =  132 bits (319), Expect = 3e-31
 Identities = 60/87 (68%), Positives = 73/87 (83%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFYVRCA+ILRH+Y RSP GV ++TKI+GGRKRNGV PSHFCR++   ARKALQ+LE  +
Sbjct: 52  WFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHAR 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           LVEK  DGGR L++ G+RDLDRIA Q+
Sbjct: 112 LVEKHPDGGRKLSSIGQRDLDRIANQI 138



 Score = 77.4 bits (182), Expect = 1e-14
 Identities = 33/50 (66%), Positives = 41/50 (82%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           M  VTVKD++Q  + K VA  LKKTGK+KVP+ MD++KTA+FKELAPYDP
Sbjct: 1   MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIIKTAKFKELAPYDP 50


>AY118868-1|AAM50728.1|  156|Drosophila melanogaster GM26647p
           protein.
          Length = 156

 Score =  132 bits (319), Expect = 3e-31
 Identities = 60/87 (68%), Positives = 73/87 (83%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFYVRCA+ILRH+Y RSP GV ++TKI+GGRKRNGV PSHFCR++   ARKALQ+LE  +
Sbjct: 52  WFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHAR 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           LVEK  DGGR L++ G+RDLDRIA Q+
Sbjct: 112 LVEKHPDGGRKLSSIGQRDLDRIANQI 138



 Score = 77.8 bits (183), Expect = 9e-15
 Identities = 34/50 (68%), Positives = 41/50 (82%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           M  VTVKD++Q  + K VA  LKKTGK+KVP+ MD+VKTA+FKELAPYDP
Sbjct: 1   MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDP 50


>AF216206-1|AAF65682.1|  156|Drosophila melanogaster ribosomal
           protein S19 protein.
          Length = 156

 Score =  132 bits (319), Expect = 3e-31
 Identities = 60/87 (68%), Positives = 73/87 (83%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFYVRCA+ILRH+Y RSP GV ++TKI+GGRKRNGV PSHFCR++   ARKALQ+LE  +
Sbjct: 52  WFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHAR 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           LVEK  DGGR L++ G+RDLDRIA Q+
Sbjct: 112 LVEKHPDGGRKLSSIGQRDLDRIANQI 138



 Score = 77.8 bits (183), Expect = 9e-15
 Identities = 34/50 (68%), Positives = 41/50 (82%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           M  VTVKD++Q  + K VA  LKKTGK+KVP+ MD+VKTA+FKELAPYDP
Sbjct: 1   MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDP 50


>AE014298-2436|AAN09413.1|  156|Drosophila melanogaster CG4464-PC,
           isoform C protein.
          Length = 156

 Score =  132 bits (319), Expect = 3e-31
 Identities = 60/87 (68%), Positives = 73/87 (83%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFYVRCA+ILRH+Y RSP GV ++TKI+GGRKRNGV PSHFCR++   ARKALQ+LE  +
Sbjct: 52  WFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHAR 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           LVEK  DGGR L++ G+RDLDRIA Q+
Sbjct: 112 LVEKHPDGGRKLSSIGQRDLDRIANQI 138



 Score = 77.8 bits (183), Expect = 9e-15
 Identities = 34/50 (68%), Positives = 41/50 (82%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           M  VTVKD++Q  + K VA  LKKTGK+KVP+ MD+VKTA+FKELAPYDP
Sbjct: 1   MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDP 50


>AE014298-2435|AAN09412.1|  156|Drosophila melanogaster CG4464-PB,
           isoform B protein.
          Length = 156

 Score =  132 bits (319), Expect = 3e-31
 Identities = 60/87 (68%), Positives = 73/87 (83%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFYVRCA+ILRH+Y RSP GV ++TKI+GGRKRNGV PSHFCR++   ARKALQ+LE  +
Sbjct: 52  WFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHAR 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           LVEK  DGGR L++ G+RDLDRIA Q+
Sbjct: 112 LVEKHPDGGRKLSSIGQRDLDRIANQI 138



 Score = 77.8 bits (183), Expect = 9e-15
 Identities = 34/50 (68%), Positives = 41/50 (82%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           M  VTVKD++Q  + K VA  LKKTGK+KVP+ MD+VKTA+FKELAPYDP
Sbjct: 1   MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDP 50


>AE014298-2434|AAF48633.1|  156|Drosophila melanogaster CG4464-PA,
           isoform A protein.
          Length = 156

 Score =  132 bits (319), Expect = 3e-31
 Identities = 60/87 (68%), Positives = 73/87 (83%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFYVRCA+ILRH+Y RSP GV ++TKI+GGRKRNGV PSHFCR++   ARKALQ+LE  +
Sbjct: 52  WFYVRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARKALQALEHAR 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           LVEK  DGGR L++ G+RDLDRIA Q+
Sbjct: 112 LVEKHPDGGRKLSSIGQRDLDRIANQI 138



 Score = 77.8 bits (183), Expect = 9e-15
 Identities = 34/50 (68%), Positives = 41/50 (82%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDP 184
           M  VTVKD++Q  + K VA  LKKTGK+KVP+ MD+VKTA+FKELAPYDP
Sbjct: 1   MPGVTVKDIDQHAVTKAVAVFLKKTGKLKVPDQMDIVKTAKFKELAPYDP 50


>AY119257-1|AAM51117.1|  155|Drosophila melanogaster SD22440p
           protein.
          Length = 155

 Score =  121 bits (292), Expect = 5e-28
 Identities = 54/87 (62%), Positives = 67/87 (77%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY RCA+I+RH+Y+RSP GV   TK++ GRKRNGV PS  CRSS    RKALQ+LEA  
Sbjct: 52  WFYTRCASIMRHLYLRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAAN 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +VE+  DGGR LT QG+R+LDRIA ++
Sbjct: 112 MVERHPDGGRKLTPQGQRNLDRIANKI 138



 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 25/49 (51%), Positives = 34/49 (69%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           M  VTVK+++Q  + K +AA LKK+GK+ VPE    +KT +FKE AP D
Sbjct: 1   MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTD 49


>AE014297-3411|AAN13960.1|  155|Drosophila melanogaster CG5338-PB
           protein.
          Length = 155

 Score =  121 bits (292), Expect = 5e-28
 Identities = 54/87 (62%), Positives = 67/87 (77%)
 Frame = +3

Query: 189 WFYVRCAAILRHIYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALK 368
           WFY RCA+I+RH+Y+RSP GV   TK++ GRKRNGV PS  CRSS    RKALQ+LEA  
Sbjct: 52  WFYTRCASIMRHLYLRSPAGVGAFTKVYSGRKRNGVRPSKHCRSSDGCIRKALQALEAAN 111

Query: 369 LVEKVQDGGRILTTQGRRDLDRIAAQV 449
           +VE+  DGGR LT QG+R+LDRIA ++
Sbjct: 112 MVERHPDGGRKLTPQGQRNLDRIANKI 138



 Score = 54.4 bits (125), Expect = 9e-08
 Identities = 25/49 (51%), Positives = 34/49 (69%)
 Frame = +2

Query: 35  MRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYD 181
           M  VTVK+++Q  + K +AA LKK+GK+ VPE    +KT +FKE AP D
Sbjct: 1   MPGVTVKEIDQHVLTKNMAAFLKKSGKIFVPEQAVYMKTGKFKETAPTD 49


>AJ271740-1|CAB93524.1| 16215|Drosophila melanogaster D-Titin protein.
          Length = 16215

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +2

Query: 20   PTQGKMRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDL 142
            P + K+  V ++ VE+ K  + V    +KT KVK P+H DL
Sbjct: 6143 PEEVKLEEVDLQHVEK-KEDEIVQEEKRKTRKVKKPKHEDL 6182


>AE014296-405|AAG22226.2| 18074|Drosophila melanogaster CG1915-PC,
            isoform C protein.
          Length = 18074

 Score = 28.3 bits (60), Expect = 6.8
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +2

Query: 20   PTQGKMRSVTVKDVEQDKIVKTVAAHLKKTGKVKVPEHMDL 142
            P + K+  V ++ VE+ K  + V    +KT KVK P+H DL
Sbjct: 6143 PEEVKLEEVDLQHVEK-KEDEIVQEEKRKTRKVKKPKHEDL 6182


>AY061282-1|AAL28830.1|  378|Drosophila melanogaster LD20087p
           protein.
          Length = 378

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 2/63 (3%)
 Frame = -3

Query: 471 PAAWPLDEPGQRFCQGLVYLVW*ECDHRPELSQQASM--PPTIAKPCVQYCLMTCRNVKV 298
           P   P +EP QR   GL +      D++  +  +  +  PP I       CL  C  VK+
Sbjct: 139 PVKLPREEPAQRISFGLRHCAVLTQDNKIYVFGRLRIMDPPPIELDITATCLHRCNTVKI 198

Query: 297 *LH 289
            +H
Sbjct: 199 QVH 201


>AE014134-264|AAF51367.2|  378|Drosophila melanogaster CG7420-PA
           protein.
          Length = 378

 Score = 27.9 bits (59), Expect = 9.0
 Identities = 18/63 (28%), Positives = 27/63 (42%), Gaps = 2/63 (3%)
 Frame = -3

Query: 471 PAAWPLDEPGQRFCQGLVYLVW*ECDHRPELSQQASM--PPTIAKPCVQYCLMTCRNVKV 298
           P   P +EP QR   GL +      D++  +  +  +  PP I       CL  C  VK+
Sbjct: 139 PVKLPREEPAQRISFGLRHCAVLTQDNKIYVFGRLRIMDPPPIELDITATCLHRCNTVKI 198

Query: 297 *LH 289
            +H
Sbjct: 199 QVH 201


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,869,789
Number of Sequences: 53049
Number of extensions: 470937
Number of successful extensions: 1186
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1147
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1186
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1970722560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -