SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A19
         (601 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014134-364|AAF51285.1|  100|Drosophila melanogaster CG15387-PA...   111   7e-25
BT021204-1|AAX33352.1| 1072|Drosophila melanogaster UT01249p pro...    33   0.30 
AL035632-3|CAB38464.1| 1072|Drosophila melanogaster EG:BACN32G11...    33   0.30 
AE014298-208|AAF45626.1| 1072|Drosophila melanogaster CG14786-PA...    33   0.30 
BT022707-1|AAY55123.1| 1316|Drosophila melanogaster RH74732p pro...    28   8.4  
AE014134-129|AAF51478.2| 1340|Drosophila melanogaster CG2807-PA ...    28   8.4  

>AE014134-364|AAF51285.1|  100|Drosophila melanogaster CG15387-PA
           protein.
          Length = 100

 Score =  111 bits (267), Expect = 7e-25
 Identities = 50/96 (52%), Positives = 74/96 (77%)
 Frame = +1

Query: 178 EIIDALESPDYASKLDEAKEAAGNEMLKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQF 357
           +II  +  P+ + KL EAK +AG EM+ MMQ VFP+V+Q+++E IK HGF  +REG+VQF
Sbjct: 2   DIIRCVNQPENSKKLSEAKASAGKEMILMMQHVFPLVMQLQLEVIKGHGFPGNREGLVQF 61

Query: 358 TQLIRDLESIDGEVARLHTQIRSHYLPPVSISSSVD 465
           +QLIR++E  D E+ RL +QIR+ YLPP++I+++ D
Sbjct: 62  SQLIREMERDDMEIVRLRSQIRAIYLPPIAINTTND 97


>BT021204-1|AAX33352.1| 1072|Drosophila melanogaster UT01249p
           protein.
          Length = 1072

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 18/71 (25%), Positives = 40/71 (56%)
 Frame = +1

Query: 253 MLKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHY 432
           ML+++  +  + V+ + ET++H+ F + R+ +VQ  + ++ LES   + ++    + SH 
Sbjct: 464 MLRLVSEMRRLRVECDEETLRHYLFPHLRQTLVQPLEAVKALESAGVKPSQTLCPVVSHL 523

Query: 433 LPPVSISSSVD 465
           L    +S  +D
Sbjct: 524 LQQHQMSEVLD 534


>AL035632-3|CAB38464.1| 1072|Drosophila melanogaster EG:BACN32G11.3
           protein.
          Length = 1072

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 18/71 (25%), Positives = 40/71 (56%)
 Frame = +1

Query: 253 MLKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHY 432
           ML+++  +  + V+ + ET++H+ F + R+ +VQ  + ++ LES   + ++    + SH 
Sbjct: 464 MLRLVSEMRRLRVECDEETLRHYLFPHLRQTLVQPLEAVKALESAGVKPSQTLCPVVSHL 523

Query: 433 LPPVSISSSVD 465
           L    +S  +D
Sbjct: 524 LQQHQMSEVLD 534


>AE014298-208|AAF45626.1| 1072|Drosophila melanogaster CG14786-PA
           protein.
          Length = 1072

 Score = 33.1 bits (72), Expect = 0.30
 Identities = 18/71 (25%), Positives = 40/71 (56%)
 Frame = +1

Query: 253 MLKMMQIVFPMVVQIEMETIKHHGFNNSREGIVQFTQLIRDLESIDGEVARLHTQIRSHY 432
           ML+++  +  + V+ + ET++H+ F + R+ +VQ  + ++ LES   + ++    + SH 
Sbjct: 464 MLRLVSEMRRLRVECDEETLRHYLFPHLRQTLVQPLEAVKALESAGVKPSQTLCPVVSHL 523

Query: 433 LPPVSISSSVD 465
           L    +S  +D
Sbjct: 524 LQQHQMSEVLD 534


>BT022707-1|AAY55123.1| 1316|Drosophila melanogaster RH74732p
           protein.
          Length = 1316

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 12/26 (46%), Positives = 13/26 (50%)
 Frame = -1

Query: 445 TQGAGSGFGFEYEDGQPHHQCSPGHE 368
           T GA  G G    D  P H  +PGHE
Sbjct: 279 TPGATPGLGTRIWDATPAHAVTPGHE 304


>AE014134-129|AAF51478.2| 1340|Drosophila melanogaster CG2807-PA
           protein.
          Length = 1340

 Score = 28.3 bits (60), Expect = 8.4
 Identities = 12/26 (46%), Positives = 13/26 (50%)
 Frame = -1

Query: 445 TQGAGSGFGFEYEDGQPHHQCSPGHE 368
           T GA  G G    D  P H  +PGHE
Sbjct: 259 TPGATPGLGTRIWDATPAHAVTPGHE 284


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,142,074
Number of Sequences: 53049
Number of extensions: 518001
Number of successful extensions: 2294
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1664
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2290
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2441585082
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -