SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A18
         (487 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY089676-1|AAL90414.1|  168|Drosophila melanogaster RH48056p pro...   175   2e-44
AE014297-925|AAN13422.1|  168|Drosophila melanogaster CG9354-PB,...   175   2e-44
AE014297-924|AAF54369.1|  168|Drosophila melanogaster CG9354-PA,...   175   2e-44
AE014297-3917|AAN14070.1|  162|Drosophila melanogaster CG6090-PB...   175   4e-44
AE014297-3916|AAF56564.2|  162|Drosophila melanogaster CG6090-PA...   175   4e-44
AY071577-1|AAL49199.1|  162|Drosophila melanogaster RE63456p pro...   171   3e-43
AE014134-1389|AAF52597.3| 2898|Drosophila melanogaster CG7466-PA...    31   0.84 
AE014297-3919|AAF56566.1|  201|Drosophila melanogaster CG14551-P...    30   1.5  
BT022454-1|AAY54870.1|  135|Drosophila melanogaster IP05788p pro...    29   4.5  
BT022433-1|AAY54849.1|  135|Drosophila melanogaster IP05688p pro...    29   4.5  
AY113610-1|AAM29615.1|  827|Drosophila melanogaster RH61467p pro...    28   7.8  
AE014298-1218|AAF46401.2|  827|Drosophila melanogaster CG12772-P...    28   7.8  

>AY089676-1|AAL90414.1|  168|Drosophila melanogaster RH48056p
           protein.
          Length = 168

 Score =  175 bits (427), Expect = 2e-44
 Identities = 80/104 (76%), Positives = 90/104 (86%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRLT RRRLSYNT+SN+RRIVRTPGGRLVYQYVKK   +PRCGQCK KL+GI P+RP+
Sbjct: 1   MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKLKGITPSRPS 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKVL 342
           ER R+  R KTV R YGGVLCH C+++RIVRAFLIEEQKIVK L
Sbjct: 61  ERPRMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKIVKAL 104


>AE014297-925|AAN13422.1|  168|Drosophila melanogaster CG9354-PB,
           isoform B protein.
          Length = 168

 Score =  175 bits (427), Expect = 2e-44
 Identities = 80/104 (76%), Positives = 90/104 (86%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRLT RRRLSYNT+SN+RRIVRTPGGRLVYQYVKK   +PRCGQCK KL+GI P+RP+
Sbjct: 1   MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKLKGITPSRPS 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKVL 342
           ER R+  R KTV R YGGVLCH C+++RIVRAFLIEEQKIVK L
Sbjct: 61  ERPRMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKIVKAL 104


>AE014297-924|AAF54369.1|  168|Drosophila melanogaster CG9354-PA,
           isoform A protein.
          Length = 168

 Score =  175 bits (427), Expect = 2e-44
 Identities = 80/104 (76%), Positives = 90/104 (86%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRLT RRRLSYNT+SN+RRIVRTPGGRLVYQYVKK   +PRCGQCK KL+GI P+RP+
Sbjct: 1   MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKLKGITPSRPS 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKVL 342
           ER R+  R KTV R YGGVLCH C+++RIVRAFLIEEQKIVK L
Sbjct: 61  ERPRMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKIVKAL 104


>AE014297-3917|AAN14070.1|  162|Drosophila melanogaster CG6090-PB,
           isoform B protein.
          Length = 162

 Score =  175 bits (425), Expect = 4e-44
 Identities = 80/104 (76%), Positives = 89/104 (85%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRLT RRRLSYNT+SN+RRIVRTPGGRLVYQYVKK   +PRCGQCK KL GI P+RP+
Sbjct: 1   MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKLHGITPSRPS 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKVL 342
           ER R+  R KTV R YGGVLCH C+++RIVRAFLIEEQKIVK L
Sbjct: 61  ERPRMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKIVKAL 104


>AE014297-3916|AAF56564.2|  162|Drosophila melanogaster CG6090-PA,
           isoform A protein.
          Length = 162

 Score =  175 bits (425), Expect = 4e-44
 Identities = 80/104 (76%), Positives = 89/104 (85%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRLT RRRLSYNT+SN+RRIVRTPGGRLVYQYVKK   +PRCGQCK KL GI P+RP+
Sbjct: 1   MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKLHGITPSRPS 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKVL 342
           ER R+  R KTV R YGGVLCH C+++RIVRAFLIEEQKIVK L
Sbjct: 61  ERPRMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKIVKAL 104


>AY071577-1|AAL49199.1|  162|Drosophila melanogaster RE63456p
           protein.
          Length = 162

 Score =  171 bits (417), Expect = 3e-43
 Identities = 79/104 (75%), Positives = 88/104 (84%)
 Frame = +1

Query: 31  MVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPA 210
           MVQRLT RRRLSYNT+SN+RRIVRTPGGRLVYQYVKK   +PRCGQCK KL GI  +RP+
Sbjct: 1   MVQRLTLRRRLSYNTRSNKRRIVRTPGGRLVYQYVKKNPTVPRCGQCKEKLHGITASRPS 60

Query: 211 ERSRLCYRKKTVKRVYGGVLCHKCVKQRIVRAFLIEEQKIVKVL 342
           ER R+  R KTV R YGGVLCH C+++RIVRAFLIEEQKIVK L
Sbjct: 61  ERPRMSKRLKTVSRTYGGVLCHSCLRERIVRAFLIEEQKIVKAL 104


>AE014134-1389|AAF52597.3| 2898|Drosophila melanogaster CG7466-PA
           protein.
          Length = 2898

 Score = 31.1 bits (67), Expect = 0.84
 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 1/24 (4%)
 Frame = -1

Query: 193 GYHG-VCSCTDHTLGSSWAFLHTD 125
           GY G +C  +DH  GSSW +L TD
Sbjct: 204 GYSGRLCDLSDHPAGSSWRWLATD 227


>AE014297-3919|AAF56566.1|  201|Drosophila melanogaster CG14551-PA
           protein.
          Length = 201

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 1/62 (1%)
 Frame = +1

Query: 100 RTPGGRLVYQYVKKPKKIPRCGQCKSKLRGIQPARPAERSRLC-YRKKTVKRVYGGVLCH 276
           + P G L+Y  + KP  + RC  C       + A P +R+     RK   ++    V  H
Sbjct: 115 KQPPGPLIYGMLPKPAVVGRCPTCSGNPERTEVAIPEQRTPWAPERKSWNRKTQEQVKPH 174

Query: 277 KC 282
           +C
Sbjct: 175 RC 176


>BT022454-1|AAY54870.1|  135|Drosophila melanogaster IP05788p
           protein.
          Length = 135

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 20/76 (26%), Positives = 37/76 (48%)
 Frame = +1

Query: 13  LSKSLKMVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGI 192
           LS ++K         +LSY TKSN   +++ P        VK  KK+ +  +CK + R +
Sbjct: 65  LSNNIKNFNNNEKIMQLSYITKSNVNSVIKFPA-----MSVKDKKKLNKKNKCK-RTRKV 118

Query: 193 QPARPAERSRLCYRKK 240
           +  +  ++ +   +KK
Sbjct: 119 EKKKKKKKKKKKKKKK 134


>BT022433-1|AAY54849.1|  135|Drosophila melanogaster IP05688p
           protein.
          Length = 135

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 20/76 (26%), Positives = 37/76 (48%)
 Frame = +1

Query: 13  LSKSLKMVQRLTFRRRLSYNTKSNQRRIVRTPGGRLVYQYVKKPKKIPRCGQCKSKLRGI 192
           LS ++K         +LSY TKSN   +++ P        VK  KK+ +  +CK + R +
Sbjct: 65  LSNNIKNFNNNEKIMQLSYITKSNVNSVIKFPA-----MSVKDKKKLNKKNKCK-RTRKV 118

Query: 193 QPARPAERSRLCYRKK 240
           +  +  ++ +   +KK
Sbjct: 119 EKKKKKKKKKKKKKKK 134


>AY113610-1|AAM29615.1|  827|Drosophila melanogaster RH61467p
           protein.
          Length = 827

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 9/21 (42%), Positives = 14/21 (66%)
 Frame = +1

Query: 109 GGRLVYQYVKKPKKIPRCGQC 171
           GG L+Y + +K ++  RCG C
Sbjct: 777 GGELIYPWQRKVQRCDRCGAC 797


>AE014298-1218|AAF46401.2|  827|Drosophila melanogaster CG12772-PA
           protein.
          Length = 827

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 9/21 (42%), Positives = 14/21 (66%)
 Frame = +1

Query: 109 GGRLVYQYVKKPKKIPRCGQC 171
           GG L+Y + +K ++  RCG C
Sbjct: 777 GGELIYPWQRKVQRCDRCGAC 797


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,052,140
Number of Sequences: 53049
Number of extensions: 390501
Number of successful extensions: 1317
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 1261
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1317
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1705394754
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -