SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A17
         (656 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT014913-1|AAT47764.1|  256|Drosophila melanogaster RH21963p pro...   322   2e-88
AY071342-1|AAL48964.1|  256|Drosophila melanogaster RE37829p pro...   322   2e-88
AF098520-1|AAF06828.1|  256|Drosophila melanogaster ribosomal pr...   322   2e-88
AE014296-477|AAF47660.1|  256|Drosophila melanogaster CG1263-PB,...   322   2e-88
AE014296-476|AAF47659.1|  256|Drosophila melanogaster CG1263-PA,...   322   2e-88
BT022891-1|AAY55307.1|  579|Drosophila melanogaster IP12501p pro...   301   4e-82
AY113486-1|AAM29491.1|  294|Drosophila melanogaster RE45450p pro...    43   3e-04
AE014296-1910|AAF50091.1|  294|Drosophila melanogaster CG7636-PA...    43   3e-04
AY070942-1|AAL48564.1|  286|Drosophila melanogaster RE03883p pro...    29   7.3  
AE013599-1623|AAF58435.2|  286|Drosophila melanogaster CG13321-P...    29   7.3  

>BT014913-1|AAT47764.1|  256|Drosophila melanogaster RH21963p
           protein.
          Length = 256

 Score =  322 bits (792), Expect = 2e-88
 Identities = 148/185 (80%), Positives = 165/185 (89%)
 Frame = +3

Query: 102 RRRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAP 281
           +R+G A L      +AER GYI+GVVKDIIHDPGRGAPLAVVHFRDPY++K RKELFIAP
Sbjct: 22  KRKGAAKLRSL--DFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAP 79

Query: 282 EGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGH 461
           EG++TGQFVYCG+KATL++GNVMP+  MPEGTI+CNLEEK GDRGRLAR SGN+ATVI H
Sbjct: 80  EGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAH 139

Query: 462 NPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYV 641
           N D K+TRVKLPSGAKKV+PS+NR MVGIVAGGGRIDKPILKAGRAYHKYKVKRN WP V
Sbjct: 140 NQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKV 199

Query: 642 RGVAM 656
           RGVAM
Sbjct: 200 RGVAM 204



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRKGAGSVF +H KKRKGA KLRSL
Sbjct: 7   AQRKGAGSVFKAHVKKRKGAAKLRSL 32


>AY071342-1|AAL48964.1|  256|Drosophila melanogaster RE37829p
           protein.
          Length = 256

 Score =  322 bits (792), Expect = 2e-88
 Identities = 148/185 (80%), Positives = 165/185 (89%)
 Frame = +3

Query: 102 RRRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAP 281
           +R+G A L      +AER GYI+GVVKDIIHDPGRGAPLAVVHFRDPY++K RKELFIAP
Sbjct: 22  KRKGAAKLRSL--DFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAP 79

Query: 282 EGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGH 461
           EG++TGQFVYCG+KATL++GNVMP+  MPEGTI+CNLEEK GDRGRLAR SGN+ATVI H
Sbjct: 80  EGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAH 139

Query: 462 NPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYV 641
           N D K+TRVKLPSGAKKV+PS+NR MVGIVAGGGRIDKPILKAGRAYHKYKVKRN WP V
Sbjct: 140 NQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKV 199

Query: 642 RGVAM 656
           RGVAM
Sbjct: 200 RGVAM 204



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRKGAGSVF +H KKRKGA KLRSL
Sbjct: 7   AQRKGAGSVFKAHVKKRKGAAKLRSL 32


>AF098520-1|AAF06828.1|  256|Drosophila melanogaster ribosomal
           protein L8 protein.
          Length = 256

 Score =  322 bits (792), Expect = 2e-88
 Identities = 148/185 (80%), Positives = 165/185 (89%)
 Frame = +3

Query: 102 RRRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAP 281
           +R+G A L      +AER GYI+GVVKDIIHDPGRGAPLAVVHFRDPY++K RKELFIAP
Sbjct: 22  KRKGAAKLRSL--DFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAP 79

Query: 282 EGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGH 461
           EG++TGQFVYCG+KATL++GNVMP+  MPEGTI+CNLEEK GDRGRLAR SGN+ATVI H
Sbjct: 80  EGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAH 139

Query: 462 NPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYV 641
           N D K+TRVKLPSGAKKV+PS+NR MVGIVAGGGRIDKPILKAGRAYHKYKVKRN WP V
Sbjct: 140 NQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKV 199

Query: 642 RGVAM 656
           RGVAM
Sbjct: 200 RGVAM 204



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRKGAGSVF +H KKRKGA KLRSL
Sbjct: 7   AQRKGAGSVFKAHVKKRKGAAKLRSL 32


>AE014296-477|AAF47660.1|  256|Drosophila melanogaster CG1263-PB,
           isoform B protein.
          Length = 256

 Score =  322 bits (792), Expect = 2e-88
 Identities = 148/185 (80%), Positives = 165/185 (89%)
 Frame = +3

Query: 102 RRRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAP 281
           +R+G A L      +AER GYI+GVVKDIIHDPGRGAPLAVVHFRDPY++K RKELFIAP
Sbjct: 22  KRKGAAKLRSL--DFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAP 79

Query: 282 EGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGH 461
           EG++TGQFVYCG+KATL++GNVMP+  MPEGTI+CNLEEK GDRGRLAR SGN+ATVI H
Sbjct: 80  EGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAH 139

Query: 462 NPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYV 641
           N D K+TRVKLPSGAKKV+PS+NR MVGIVAGGGRIDKPILKAGRAYHKYKVKRN WP V
Sbjct: 140 NQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKV 199

Query: 642 RGVAM 656
           RGVAM
Sbjct: 200 RGVAM 204



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRKGAGSVF +H KKRKGA KLRSL
Sbjct: 7   AQRKGAGSVFKAHVKKRKGAAKLRSL 32


>AE014296-476|AAF47659.1|  256|Drosophila melanogaster CG1263-PA,
           isoform A protein.
          Length = 256

 Score =  322 bits (792), Expect = 2e-88
 Identities = 148/185 (80%), Positives = 165/185 (89%)
 Frame = +3

Query: 102 RRRGKALLNFAL*XYAERHGYIKGVVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAP 281
           +R+G A L      +AER GYI+GVVKDIIHDPGRGAPLAVVHFRDPY++K RKELFIAP
Sbjct: 22  KRKGAAKLRSL--DFAERSGYIRGVVKDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAP 79

Query: 282 EGLYTGQFVYCGKKATLEVGNVMPVGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGH 461
           EG++TGQFVYCG+KATL++GNVMP+  MPEGTI+CNLEEK GDRGRLAR SGN+ATVI H
Sbjct: 80  EGMHTGQFVYCGRKATLQIGNVMPLSQMPEGTIICNLEEKTGDRGRLARTSGNYATVIAH 139

Query: 462 NPDAKRTRVKLPSGAKKVLPSSNRGMVGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYV 641
           N D K+TRVKLPSGAKKV+PS+NR MVGIVAGGGRIDKPILKAGRAYHKYKVKRN WP V
Sbjct: 140 NQDTKKTRVKLPSGAKKVVPSANRAMVGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKV 199

Query: 642 RGVAM 656
           RGVAM
Sbjct: 200 RGVAM 204



 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 22/26 (84%), Positives = 23/26 (88%)
 Frame = +2

Query: 62  AQRKGAGSVFVSHTKKRKGAPKLRSL 139
           AQRKGAGSVF +H KKRKGA KLRSL
Sbjct: 7   AQRKGAGSVFKAHVKKRKGAAKLRSL 32


>BT022891-1|AAY55307.1|  579|Drosophila melanogaster IP12501p
           protein.
          Length = 579

 Score =  301 bits (740), Expect = 4e-82
 Identities = 135/159 (84%), Positives = 148/159 (93%)
 Frame = +3

Query: 180 KDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVMPVG 359
           KDIIHDPGRGAPLAVVHFRDPY++K RKELFIAPEG++TGQFVYCG+KATL++GNVMP+ 
Sbjct: 1   KDIIHDPGRGAPLAVVHFRDPYRYKIRKELFIAPEGMHTGQFVYCGRKATLQIGNVMPLS 60

Query: 360 AMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPSGAKKVLPSSNRGM 539
            MPEGTI+CNLEEK GDRGRLAR SGN+ATVI HN D K+TRVKLPSGAKKV+PS+NR M
Sbjct: 61  QMPEGTIICNLEEKTGDRGRLARTSGNYATVIAHNQDTKKTRVKLPSGAKKVVPSANRAM 120

Query: 540 VGIVAGGGRIDKPILKAGRAYHKYKVKRNCWPYVRGVAM 656
           VGIVAGGGRIDKPILKAGRAYHKYKVKRN WP VRGVAM
Sbjct: 121 VGIVAGGGRIDKPILKAGRAYHKYKVKRNSWPKVRGVAM 159


>AY113486-1|AAM29491.1|  294|Drosophila melanogaster RE45450p
           protein.
          Length = 294

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 33/109 (30%), Positives = 54/109 (49%)
 Frame = +3

Query: 174 VVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVMP 353
           +V +++ D  R A +A+V   D  K+    E   A + L T +F+        E G+  P
Sbjct: 107 LVLEVLRDGCRTAKVALVAVGDELKYILATENMKAGDILKTSRFIPRIPVRPNE-GDAYP 165

Query: 354 VGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPS 500
           +GA+P GT +  LE+  G    L  A+G F T++      ++  V+LPS
Sbjct: 166 LGALPVGTRIHCLEKNPGQMCHLIHAAGTFGTIL--RKFDEKVVVQLPS 212


>AE014296-1910|AAF50091.1|  294|Drosophila melanogaster CG7636-PA
           protein.
          Length = 294

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 33/109 (30%), Positives = 54/109 (49%)
 Frame = +3

Query: 174 VVKDIIHDPGRGAPLAVVHFRDPYKFKTRKELFIAPEGLYTGQFVYCGKKATLEVGNVMP 353
           +V +++ D  R A +A+V   D  K+    E   A + L T +F+        E G+  P
Sbjct: 107 LVLEVLRDGCRTAKVALVAVGDELKYILATENMKAGDILKTSRFIPRIPVRPNE-GDAYP 165

Query: 354 VGAMPEGTIVCNLEEKMGDRGRLARASGNFATVIGHNPDAKRTRVKLPS 500
           +GA+P GT +  LE+  G    L  A+G F T++      ++  V+LPS
Sbjct: 166 LGALPVGTRIHCLEKNPGQMCHLIHAAGTFGTIL--RKFDEKVVVQLPS 212


>AY070942-1|AAL48564.1|  286|Drosophila melanogaster RE03883p
           protein.
          Length = 286

 Score = 28.7 bits (61), Expect = 7.3
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +3

Query: 516 LPSSNRGMV-GIVAGGGRIDKPILKAGRAYHK 608
           + SS RG+V G V GG   D   +  GRAYH+
Sbjct: 149 IASSGRGIVPGTVVGGHDADGDQIYVGRAYHE 180


>AE013599-1623|AAF58435.2|  286|Drosophila melanogaster CG13321-PA
           protein.
          Length = 286

 Score = 28.7 bits (61), Expect = 7.3
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
 Frame = +3

Query: 516 LPSSNRGMV-GIVAGGGRIDKPILKAGRAYHK 608
           + SS RG+V G V GG   D   +  GRAYH+
Sbjct: 149 IASSGRGIVPGTVVGGHDADGDQIYVGRAYHE 180


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 31,850,830
Number of Sequences: 53049
Number of extensions: 724714
Number of successful extensions: 1967
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1874
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1967
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2806815600
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -