SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A16
         (653 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT024989-1|ABE01219.1|  323|Drosophila melanogaster IP10750p pro...    84   2e-16
AE013599-1346|AAF58620.1|  323|Drosophila melanogaster CG13192-P...    84   2e-16
AY118386-1|AAM48415.1|  361|Drosophila melanogaster RE31658p pro...    31   1.4  
AL138972-9|CAB72292.1|  361|Drosophila melanogaster EG:BACR25B3....    31   1.4  
AF233288-1|AAF43418.1|  361|Drosophila melanogaster WDS protein.       31   1.4  
AE014298-414|AAF45791.1|  361|Drosophila melanogaster CG17437-PA...    31   1.4  
BT011170-1|AAR84385.1|  897|Drosophila melanogaster AT01547p pro...    30   2.4  
AE014296-1292|AAF50537.1| 1132|Drosophila melanogaster CG14838-P...    30   2.4  
X03734-1|CAA27371.1|  930|Drosophila melanogaster protein ( D. m...    28   9.6  
M12927-2|AAA70219.1| 1010|Drosophila melanogaster unknown protei...    28   9.6  
EF591043-2|ABQ84946.1| 1045|Drosophila melanogaster pol protein ...    28   9.6  
EF591042-2|ABQ84943.1| 1045|Drosophila melanogaster pol protein ...    28   9.6  
BT024997-1|ABE01227.1|  496|Drosophila melanogaster IP08220p pro...    28   9.6  
AF033821-2|AAC82604.1| 1463|Drosophila melanogaster Prgag-pol pr...    28   9.6  
AE013599-3128|AAF46671.1|  221|Drosophila melanogaster CG15654-P...    28   9.6  

>BT024989-1|ABE01219.1|  323|Drosophila melanogaster IP10750p
           protein.
          Length = 323

 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 56/161 (34%), Positives = 83/161 (51%), Gaps = 8/161 (4%)
 Frame = +2

Query: 134 PVYTIRNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILH 313
           PV+++R+ D   V SL F       +RLLAG+  G V+ ++LQTNR     +VG  PI  
Sbjct: 8   PVFSLRSPDMGAVNSLCFQ----ESDRLLAGTIKGSVFLWDLQTNRSALHFEVGSDPITS 63

Query: 314 LIHTDSHLITQEKGGKLKVFELTNSGYEEDAVIEVDYPGFCRFEANTKLAS-----LYVP 478
           L HT   L+TQEKGG + +F +  S Y ++  I  ++ GFCR   +T  +      L+ P
Sbjct: 64  LHHTPDRLVTQEKGGTITMFSIGGSSYVKERSIPGNHLGFCRSALHTNTSKTNEQLLFYP 123

Query: 479 EKDYKINIYNFNGEKLGS--LEYDDASV-KLGDVMCLKFIE 592
            ++  I + +       +  L  DD  + KLG V C K  E
Sbjct: 124 CEESSIGVLHVTDAAAPTQILVPDDPQLPKLGSVTCFKPFE 164


>AE013599-1346|AAF58620.1|  323|Drosophila melanogaster CG13192-PA
           protein.
          Length = 323

 Score = 83.8 bits (198), Expect = 2e-16
 Identities = 56/161 (34%), Positives = 83/161 (51%), Gaps = 8/161 (4%)
 Frame = +2

Query: 134 PVYTIRNVDNVPVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQVGQAPILH 313
           PV+++R+ D   V SL F       +RLLAG+  G V+ ++LQTNR     +VG  PI  
Sbjct: 8   PVFSLRSPDMGAVNSLCFQ----ESDRLLAGTIKGSVFLWDLQTNRSALHFEVGSDPITS 63

Query: 314 LIHTDSHLITQEKGGKLKVFELTNSGYEEDAVIEVDYPGFCRFEANTKLAS-----LYVP 478
           L HT   L+TQEKGG + +F +  S Y ++  I  ++ GFCR   +T  +      L+ P
Sbjct: 64  LHHTPDRLVTQEKGGTITMFSIGGSSYVKERSIPGNHLGFCRSALHTNTSKTNEQLLFYP 123

Query: 479 EKDYKINIYNFNGEKLGS--LEYDDASV-KLGDVMCLKFIE 592
            ++  I + +       +  L  DD  + KLG V C K  E
Sbjct: 124 CEESSIGVLHVTDAAAPTQILVPDDPQLPKLGSVTCFKPFE 164


>AY118386-1|AAM48415.1|  361|Drosophila melanogaster RE31658p
           protein.
          Length = 361

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           Y +  +F   G + +++GS++  VY +NLQ+  V QK+Q
Sbjct: 287 YCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ 325


>AL138972-9|CAB72292.1|  361|Drosophila melanogaster EG:BACR25B3.7
           protein.
          Length = 361

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           Y +  +F   G + +++GS++  VY +NLQ+  V QK+Q
Sbjct: 287 YCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ 325


>AF233288-1|AAF43418.1|  361|Drosophila melanogaster WDS protein.
          Length = 361

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           Y +  +F   G + +++GS++  VY +NLQ+  V QK+Q
Sbjct: 287 YCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ 325


>AE014298-414|AAF45791.1|  361|Drosophila melanogaster CG17437-PA
           protein.
          Length = 361

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 14/39 (35%), Positives = 25/39 (64%)
 Frame = +2

Query: 173 YSLAFSFLPGGLERLLAGSKNGYVYAYNLQTNRVQQKIQ 289
           Y +  +F   G + +++GS++  VY +NLQ+  V QK+Q
Sbjct: 287 YCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ 325


>BT011170-1|AAR84385.1|  897|Drosophila melanogaster AT01547p
           protein.
          Length = 897

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +2

Query: 167 PVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQ 262
           P+ + A +F P   + LL GSKNG V  ++LQ
Sbjct: 458 PIETTALTFCPFNGDILLGGSKNGQVVLWDLQ 489


>AE014296-1292|AAF50537.1| 1132|Drosophila melanogaster CG14838-PA
           protein.
          Length = 1132

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +2

Query: 167 PVYSLAFSFLPGGLERLLAGSKNGYVYAYNLQ 262
           P+ + A +F P   + LL GSKNG V  ++LQ
Sbjct: 458 PIETTALTFCPFNGDILLGGSKNGQVVLWDLQ 489


>X03734-1|CAA27371.1|  930|Drosophila melanogaster protein ( D.
           melanogaster retrotransposongypsy gene fragment for
           reverse transcriptase-like enzyme.).
          Length = 930

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 13/20 (65%), Positives = 14/20 (70%)
 Frame = +2

Query: 143 TIRNVDNVPVYSLAFSFLPG 202
           TIR VDN PVYS A+  L G
Sbjct: 153 TIRTVDNEPVYSRAYPTLMG 172


>M12927-2|AAA70219.1| 1010|Drosophila melanogaster unknown protein
           protein.
          Length = 1010

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 13/20 (65%), Positives = 14/20 (70%)
 Frame = +2

Query: 143 TIRNVDNVPVYSLAFSFLPG 202
           TIR VDN PVYS A+  L G
Sbjct: 148 TIRTVDNEPVYSRAYPTLMG 167


>EF591043-2|ABQ84946.1| 1045|Drosophila melanogaster pol protein
           protein.
          Length = 1045

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 13/20 (65%), Positives = 14/20 (70%)
 Frame = +2

Query: 143 TIRNVDNVPVYSLAFSFLPG 202
           TIR VDN PVYS A+  L G
Sbjct: 183 TIRTVDNEPVYSRAYPTLMG 202


>EF591042-2|ABQ84943.1| 1045|Drosophila melanogaster pol protein
           protein.
          Length = 1045

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 13/20 (65%), Positives = 14/20 (70%)
 Frame = +2

Query: 143 TIRNVDNVPVYSLAFSFLPG 202
           TIR VDN PVYS A+  L G
Sbjct: 183 TIRTVDNEPVYSRAYPTLMG 202


>BT024997-1|ABE01227.1|  496|Drosophila melanogaster IP08220p
           protein.
          Length = 496

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = -2

Query: 415 FNYGIFFITTIR*FENLKLSTFLLGYKVAVSVYKMKNRSLTNLYLLL 275
           F YG F       F ++  S    G K+   +YK   R  T+++L+L
Sbjct: 5   FGYGNFMTKGYEGFLDITKSGLSFGEKMTFGMYKWSRRWFTHIFLIL 51


>AF033821-2|AAC82604.1| 1463|Drosophila melanogaster Prgag-pol
           protein.
          Length = 1463

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 13/20 (65%), Positives = 14/20 (70%)
 Frame = +2

Query: 143 TIRNVDNVPVYSLAFSFLPG 202
           TIR VDN PVYS A+  L G
Sbjct: 601 TIRTVDNEPVYSRAYPTLMG 620


>AE013599-3128|AAF46671.1|  221|Drosophila melanogaster CG15654-PA
           protein.
          Length = 221

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = -2

Query: 415 FNYGIFFITTIR*FENLKLSTFLLGYKVAVSVYKMKNRSLTNLYLLL 275
           F YG F       F ++  S    G K+   +YK   R  T+++L+L
Sbjct: 73  FGYGNFMTKGYEGFLDITKSGLSFGEKMTFGMYKWSRRWFTHIFLIL 119


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,110,287
Number of Sequences: 53049
Number of extensions: 508624
Number of successful extensions: 1170
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1140
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1170
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2786177250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -