SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A15
         (409 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY061320-1|AAL28868.1|   65|Drosophila melanogaster LD23674p pro...    98   3e-21
AE014298-1341|AAF46503.2|   65|Drosophila melanogaster CG2998-PA...    98   3e-21
AE014297-4512|AAF56992.1|   64|Drosophila melanogaster CG15527-P...    88   4e-18
BT030166-1|ABN49305.1|   73|Drosophila melanogaster IP17744p pro...    51   7e-07
BT029933-1|ABM92807.1|  575|Drosophila melanogaster IP14249p pro...    28   5.4  
AE014134-2641|AAN10914.1| 1931|Drosophila melanogaster CG18109-P...    28   5.4  
BT030187-1|ABN49326.1|  146|Drosophila melanogaster IP17943p pro...    27   7.2  
BT030165-1|ABN49304.1|  214|Drosophila melanogaster IP17743p pro...    27   7.2  
BT030152-1|ABN49291.1|  146|Drosophila melanogaster IP17643p pro...    27   7.2  
BT011094-1|AAR82760.1|  870|Drosophila melanogaster RE31380p pro...    27   9.5  
AE013599-4028|AAM68331.1|  863|Drosophila melanogaster CG9380-PB...    27   9.5  

>AY061320-1|AAL28868.1|   65|Drosophila melanogaster LD23674p
           protein.
          Length = 65

 Score = 98.3 bits (234), Expect = 3e-21
 Identities = 46/53 (86%), Positives = 50/53 (94%)
 Frame = +2

Query: 71  MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           MDKP V ARV+KVLGRTGSQGQCTQVKVEF+GE +RQIIRNVKGPVR+GDILT
Sbjct: 1   MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGDILT 53


>AE014298-1341|AAF46503.2|   65|Drosophila melanogaster CG2998-PA
           protein.
          Length = 65

 Score = 98.3 bits (234), Expect = 3e-21
 Identities = 46/53 (86%), Positives = 50/53 (94%)
 Frame = +2

Query: 71  MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           MDKP V ARV+KVLGRTGSQGQCTQVKVEF+GE +RQIIRNVKGPVR+GDILT
Sbjct: 1   MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGDILT 53


>AE014297-4512|AAF56992.1|   64|Drosophila melanogaster CG15527-PA
           protein.
          Length = 64

 Score = 88.2 bits (209), Expect = 4e-18
 Identities = 42/53 (79%), Positives = 48/53 (90%)
 Frame = +2

Query: 71  MDKPNVLARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDILT 229
           MDKP   ARVV++LGRTGSQGQCTQV+VEF+G+ SRQIIRNVKGPVR GDIL+
Sbjct: 1   MDKPQY-ARVVEILGRTGSQGQCTQVRVEFLGDQSRQIIRNVKGPVRVGDILS 52


>BT030166-1|ABN49305.1|   73|Drosophila melanogaster IP17744p
           protein.
          Length = 73

 Score = 50.8 bits (116), Expect = 7e-07
 Identities = 21/44 (47%), Positives = 32/44 (72%)
 Frame = +2

Query: 92  ARVVKVLGRTGSQGQCTQVKVEFIGETSRQIIRNVKGPVRDGDI 223
           ARV+K+L R G++G  T+V+V+ + +   Q +R VKGPVR GD+
Sbjct: 7   ARVIKILNRIGARGILTEVRVQLVDQPKMQFMRTVKGPVRLGDV 50


>BT029933-1|ABM92807.1|  575|Drosophila melanogaster IP14249p
           protein.
          Length = 575

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 12/27 (44%), Positives = 14/27 (51%)
 Frame = -1

Query: 154 DLHLSTLALRTSTAKHFHDTSKNVGFI 74
           DLH+  L L  S     HD  K+V FI
Sbjct: 32  DLHMGILELSVSLGNFTHDVEKSVNFI 58


>AE014134-2641|AAN10914.1| 1931|Drosophila melanogaster CG18109-PA
           protein.
          Length = 1931

 Score = 27.9 bits (59), Expect = 5.4
 Identities = 12/27 (44%), Positives = 14/27 (51%)
 Frame = -1

Query: 154 DLHLSTLALRTSTAKHFHDTSKNVGFI 74
           DLH+  L L  S     HD  K+V FI
Sbjct: 32  DLHMGILELSVSLGNFTHDVEKSVNFI 58


>BT030187-1|ABN49326.1|  146|Drosophila melanogaster IP17943p
           protein.
          Length = 146

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%)
 Frame = +1

Query: 91  CSCRESAWPYWFSGPVYS-SEGRVHW 165
           CSCR S + YW SG + S   G + W
Sbjct: 48  CSCRPSHFVYWLSGLITSLISGAMLW 73


>BT030165-1|ABN49304.1|  214|Drosophila melanogaster IP17743p
           protein.
          Length = 214

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%)
 Frame = +1

Query: 91  CSCRESAWPYWFSGPVYS-SEGRVHW 165
           CSCR S + YW SG + S   G + W
Sbjct: 116 CSCRPSHFVYWLSGLITSLISGAMLW 141


>BT030152-1|ABN49291.1|  146|Drosophila melanogaster IP17643p
           protein.
          Length = 146

 Score = 27.5 bits (58), Expect = 7.2
 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%)
 Frame = +1

Query: 91  CSCRESAWPYWFSGPVYS-SEGRVHW 165
           CSCR S + YW SG + S   G + W
Sbjct: 48  CSCRPSHFVYWLSGLITSLISGAMLW 73


>BT011094-1|AAR82760.1|  870|Drosophila melanogaster RE31380p
           protein.
          Length = 870

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = +1

Query: 52  LDITSQNG*TQRSCSCRESAWP 117
           L I SQNG T   C+ R  AWP
Sbjct: 745 LTIQSQNGGTYTICTSRTYAWP 766


>AE013599-4028|AAM68331.1|  863|Drosophila melanogaster CG9380-PB,
           isoform B protein.
          Length = 863

 Score = 27.1 bits (57), Expect = 9.5
 Identities = 12/22 (54%), Positives = 13/22 (59%)
 Frame = +1

Query: 52  LDITSQNG*TQRSCSCRESAWP 117
           L I SQNG T   C+ R  AWP
Sbjct: 738 LTIQSQNGGTYTICTSRTYAWP 759


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 17,338,007
Number of Sequences: 53049
Number of extensions: 314741
Number of successful extensions: 1020
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 1012
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1020
length of database: 24,988,368
effective HSP length: 78
effective length of database: 20,850,546
effective search space used: 1188481122
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -