SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A11
         (457 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT029953-1|ABM92827.1|  104|Drosophila melanogaster IP17351p pro...    89   3e-18
BT024261-1|ABC86323.1|  121|Drosophila melanogaster IP15820p pro...    89   3e-18
AE014134-1388|AAF52596.2|  104|Drosophila melanogaster CG7424-PA...    89   3e-18
AE014297-2785|AAX52968.1|  512|Drosophila melanogaster CG33518-P...    29   3.9  
AY118346-1|AAM48375.1|  285|Drosophila melanogaster LP05025p pro...    28   6.8  
AE014298-2050|AAF48385.1|  285|Drosophila melanogaster CG5347-PA...    28   6.8  

>BT029953-1|ABM92827.1|  104|Drosophila melanogaster IP17351p
           protein.
          Length = 104

 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 39/57 (68%), Positives = 43/57 (75%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           +GGQ+KPIF         IVLR+EC +CK R Q  LKRCKHFELGGDKKRKGQMIQF
Sbjct: 48  FGGQTKPIFRKKAKTTKKIVLRMECTECKYRKQTPLKRCKHFELGGDKKRKGQMIQF 104



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 21/37 (56%), Positives = 23/37 (62%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPKQRRT+            +QYKKSKER  AQG
Sbjct: 1   MVNVPKQRRTFCKKCKVHKLHKVTQYKKSKERKGAQG 37



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 19/43 (44%), Positives = 25/43 (58%)
 Frame = +1

Query: 166 KYTRYHSTKSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           K T+Y  +K  RKG   + RRRYDRKQQG     +   +K+ K
Sbjct: 22  KVTQYKKSKE-RKGA--QGRRRYDRKQQGFGGQTKPIFRKKAK 61


>BT024261-1|ABC86323.1|  121|Drosophila melanogaster IP15820p
           protein.
          Length = 121

 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 39/57 (68%), Positives = 43/57 (75%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           +GGQ+KPIF         IVLR+EC +CK R Q  LKRCKHFELGGDKKRKGQMIQF
Sbjct: 65  FGGQTKPIFRKKAKTTKKIVLRMECTECKYRKQTPLKRCKHFELGGDKKRKGQMIQF 121



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 19/43 (44%), Positives = 25/43 (58%)
 Frame = +1

Query: 166 KYTRYHSTKSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           K T+Y  +K  RKG   + RRRYDRKQQG     +   +K+ K
Sbjct: 39  KVTQYKKSKE-RKGA--QGRRRYDRKQQGFGGQTKPIFRKKAK 78


>AE014134-1388|AAF52596.2|  104|Drosophila melanogaster CG7424-PA
           protein.
          Length = 104

 Score = 89.0 bits (211), Expect = 3e-18
 Identities = 39/57 (68%), Positives = 43/57 (75%)
 Frame = +2

Query: 254 YGGQSKPIFXXXXXXXXXIVLRLECADCKVRSQVALKRCKHFELGGDKKRKGQMIQF 424
           +GGQ+KPIF         IVLR+EC +CK R Q  LKRCKHFELGGDKKRKGQMIQF
Sbjct: 48  FGGQTKPIFRKKAKTTKKIVLRMECTECKYRKQTPLKRCKHFELGGDKKRKGQMIQF 104



 Score = 43.6 bits (98), Expect = 1e-04
 Identities = 21/37 (56%), Positives = 23/37 (62%)
 Frame = +3

Query: 111 MVNVPKQRRTYXXXXXXXXXXXXSQYKKSKERHAAQG 221
           MVNVPKQRRT+            +QYKKSKER  AQG
Sbjct: 1   MVNVPKQRRTFCKKCKVHKLHKVTQYKKSKERKGAQG 37



 Score = 33.5 bits (73), Expect = 0.14
 Identities = 19/43 (44%), Positives = 25/43 (58%)
 Frame = +1

Query: 166 KYTRYHSTKSPRKGTLPRXRRRYDRKQQGLRWSVQTHLQKEGK 294
           K T+Y  +K  RKG   + RRRYDRKQQG     +   +K+ K
Sbjct: 22  KVTQYKKSKE-RKGA--QGRRRYDRKQQGFGGQTKPIFRKKAK 61


>AE014297-2785|AAX52968.1|  512|Drosophila melanogaster CG33518-PA
           protein.
          Length = 512

 Score = 28.7 bits (61), Expect = 3.9
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 5/32 (15%)
 Frame = -3

Query: 407 PFSSCHH-----RAQSACISSMQPVISPCNLH 327
           P S+CH      R   +C SS+QP+++ C LH
Sbjct: 155 PQSTCHTALDTCREDPSCSSSLQPMLTHCELH 186


>AY118346-1|AAM48375.1|  285|Drosophila melanogaster LP05025p
           protein.
          Length = 285

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -2

Query: 381 SKCLHLFNATCDLTLQSAHSRRSTI 307
           SKC H+F  TC  T + AH   +T+
Sbjct: 181 SKCKHIFCLTCIRTWRQAHQFEATV 205


>AE014298-2050|AAF48385.1|  285|Drosophila melanogaster CG5347-PA
           protein.
          Length = 285

 Score = 27.9 bits (59), Expect = 6.8
 Identities = 11/25 (44%), Positives = 15/25 (60%)
 Frame = -2

Query: 381 SKCLHLFNATCDLTLQSAHSRRSTI 307
           SKC H+F  TC  T + AH   +T+
Sbjct: 181 SKCKHIFCLTCIRTWRQAHQFEATV 205


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 19,390,340
Number of Sequences: 53049
Number of extensions: 367567
Number of successful extensions: 933
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 895
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 932
length of database: 24,988,368
effective HSP length: 79
effective length of database: 20,797,497
effective search space used: 1497419784
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -