SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A10
         (653 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY113512-1|AAM29517.1|  131|Drosophila melanogaster RE59324p pro...   222   3e-58
AE013599-3424|AAF46871.1|  131|Drosophila melanogaster CG3751-PA...   222   3e-58
BT012471-1|AAS93742.1| 1201|Drosophila melanogaster RE24802p pro...    33   0.34 
BT011364-1|AAR96156.1| 1201|Drosophila melanogaster RE66627p pro...    33   0.34 
BT003194-1|AAO24949.1|  371|Drosophila melanogaster RE59468p pro...    33   0.34 
AE014296-1742|AAN11930.1| 1161|Drosophila melanogaster CG8177-PD...    33   0.34 
AE014296-1741|AAN11929.1| 1228|Drosophila melanogaster CG8177-PE...    33   0.34 
AE014296-1740|AAS65047.1| 1166|Drosophila melanogaster CG8177-PJ...    33   0.34 
AE014296-1739|AAS65046.1| 1233|Drosophila melanogaster CG8177-PK...    33   0.34 
AE014296-1738|AAS65045.1| 1201|Drosophila melanogaster CG8177-PI...    33   0.34 
AE014296-1737|AAS65044.1| 1201|Drosophila melanogaster CG8177-PH...    33   0.34 
AE014296-1736|AAN11928.1| 1201|Drosophila melanogaster CG8177-PF...    33   0.34 
AE014296-1735|AAN11927.1| 1201|Drosophila melanogaster CG8177-PC...    33   0.34 
AE014296-1734|AAN11926.1| 1201|Drosophila melanogaster CG8177-PB...    33   0.34 
AE014296-1733|AAN11925.1| 1268|Drosophila melanogaster CG8177-PG...    33   0.34 
AE014296-1732|AAF50207.2| 1268|Drosophila melanogaster CG8177-PA...    33   0.34 
AE013599-708|AAM68835.1|  149|Drosophila melanogaster CG30356-PA...    30   2.4  
BT022756-1|AAY55172.1|  287|Drosophila melanogaster IP14752p pro...    28   9.6  

>AY113512-1|AAM29517.1|  131|Drosophila melanogaster RE59324p
           protein.
          Length = 131

 Score =  222 bits (543), Expect = 3e-58
 Identities = 104/121 (85%), Positives = 113/121 (93%)
 Frame = +1

Query: 88  MSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFG 267
           MS  TATIRTRKFMTNRLLARKQMVCDVLHPG  +V+KTEIREKLA MYKVTPDVVF FG
Sbjct: 1   MSGTTATIRTRKFMTNRLLARKQMVCDVLHPGLSSVNKTEIREKLAAMYKVTPDVVFAFG 60

Query: 268 FKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRG 447
           F+TNFGGG+STGFALIYDTLD AKKFEPK+RLARHGL+E+K+ TRKQRKER+NRMKKVRG
Sbjct: 61  FRTNFGGGRSTGFALIYDTLDFAKKFEPKYRLARHGLFEQKKQTRKQRKERRNRMKKVRG 120

Query: 448 T 450
           T
Sbjct: 121 T 121


>AE013599-3424|AAF46871.1|  131|Drosophila melanogaster CG3751-PA
           protein.
          Length = 131

 Score =  222 bits (543), Expect = 3e-58
 Identities = 104/121 (85%), Positives = 113/121 (93%)
 Frame = +1

Query: 88  MSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFG 267
           MS  TATIRTRKFMTNRLLARKQMVCDVLHPG  +V+KTEIREKLA MYKVTPDVVF FG
Sbjct: 1   MSGTTATIRTRKFMTNRLLARKQMVCDVLHPGLSSVNKTEIREKLAAMYKVTPDVVFAFG 60

Query: 268 FKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVRG 447
           F+TNFGGG+STGFALIYDTLD AKKFEPK+RLARHGL+E+K+ TRKQRKER+NRMKKVRG
Sbjct: 61  FRTNFGGGRSTGFALIYDTLDFAKKFEPKYRLARHGLFEQKKQTRKQRKERRNRMKKVRG 120

Query: 448 T 450
           T
Sbjct: 121 T 121


>BT012471-1|AAS93742.1| 1201|Drosophila melanogaster RE24802p
           protein.
          Length = 1201

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 133 FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 185


>BT011364-1|AAR96156.1| 1201|Drosophila melanogaster RE66627p
           protein.
          Length = 1201

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 133 FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 185


>BT003194-1|AAO24949.1|  371|Drosophila melanogaster RE59468p
           protein.
          Length = 371

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 93  FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 145


>AE014296-1742|AAN11930.1| 1161|Drosophila melanogaster CG8177-PD,
           isoform D protein.
          Length = 1161

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 93  FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 145


>AE014296-1741|AAN11929.1| 1228|Drosophila melanogaster CG8177-PE,
           isoform E protein.
          Length = 1228

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 93  FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 145


>AE014296-1740|AAS65047.1| 1166|Drosophila melanogaster CG8177-PJ,
           isoform J protein.
          Length = 1166

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 98  FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 150


>AE014296-1739|AAS65046.1| 1233|Drosophila melanogaster CG8177-PK,
           isoform K protein.
          Length = 1233

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 98  FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 150


>AE014296-1738|AAS65045.1| 1201|Drosophila melanogaster CG8177-PI,
           isoform I protein.
          Length = 1201

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 133 FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 185


>AE014296-1737|AAS65044.1| 1201|Drosophila melanogaster CG8177-PH,
           isoform H protein.
          Length = 1201

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 133 FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 185


>AE014296-1736|AAN11928.1| 1201|Drosophila melanogaster CG8177-PF,
           isoform F protein.
          Length = 1201

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 133 FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 185


>AE014296-1735|AAN11927.1| 1201|Drosophila melanogaster CG8177-PC,
           isoform C protein.
          Length = 1201

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 133 FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 185


>AE014296-1734|AAN11926.1| 1201|Drosophila melanogaster CG8177-PB,
           isoform B protein.
          Length = 1201

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 133 FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 185


>AE014296-1733|AAN11925.1| 1268|Drosophila melanogaster CG8177-PG,
           isoform G protein.
          Length = 1268

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 133 FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 185


>AE014296-1732|AAF50207.2| 1268|Drosophila melanogaster CG8177-PA,
           isoform A protein.
          Length = 1268

 Score = 33.1 bits (72), Expect = 0.34
 Identities = 16/53 (30%), Positives = 28/53 (52%)
 Frame = +1

Query: 280 FGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 438
           FGG K    +L YD     +  E K R +RH  Y +++ + +   E KN++++
Sbjct: 133 FGGKKKIPPSLSYDEQPTDQSHERKRRRSRHQYYRQRKFSHQDSVEPKNKLEE 185


>AE013599-708|AAM68835.1|  149|Drosophila melanogaster CG30356-PA
           protein.
          Length = 149

 Score = 30.3 bits (65), Expect = 2.4
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = +3

Query: 258 RIRFQDKLRRWQVNWIRFDLRHTRSGQEVRAQAQ 359
           R  +  + R  +VNW+   LR + +G+E R QAQ
Sbjct: 90  RFNYTYRSRSRKVNWVLAQLRKSAAGEECRPQAQ 123


>BT022756-1|AAY55172.1|  287|Drosophila melanogaster IP14752p
           protein.
          Length = 287

 Score = 28.3 bits (60), Expect = 9.6
 Identities = 15/35 (42%), Positives = 22/35 (62%)
 Frame = +1

Query: 325 LDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNR 429
           L L KK E   R+ R G   KK PT+K++K++K +
Sbjct: 254 LKLLKKLEKIERMKRKGEGIKK-PTKKKKKKKKKK 287


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,536,989
Number of Sequences: 53049
Number of extensions: 595842
Number of successful extensions: 1710
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 1621
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1708
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2786177250
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -