SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A09
         (627 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY071661-1|AAL49283.1|  318|Drosophila melanogaster RE74715p pro...   206   2e-53
AE014134-1351|AAF52566.1|  318|Drosophila melanogaster CG7111-PA...   206   2e-53
U96491-1|AAB72148.1|  318|Drosophila melanogaster RACK1 protein.      206   2e-53
AY118386-1|AAM48415.1|  361|Drosophila melanogaster RE31658p pro...    62   5e-10
AL138972-9|CAB72292.1|  361|Drosophila melanogaster EG:BACR25B3....    62   5e-10
AF233288-1|AAF43418.1|  361|Drosophila melanogaster WDS protein.       62   5e-10
AE014298-414|AAF45791.1|  361|Drosophila melanogaster CG17437-PA...    62   5e-10
AY070530-1|AAL48001.1|  347|Drosophila melanogaster GM13767p pro...    60   3e-09
AE014134-53|AAF51536.1|  347|Drosophila melanogaster CG3436-PA, ...    60   3e-09
AY051707-1|AAK93131.1|  482|Drosophila melanogaster LD24662p pro...    58   7e-09
AE014298-1742|AAF48133.1|  482|Drosophila melanogaster CG1796-PA...    58   7e-09
BT021404-1|AAX33552.1|  411|Drosophila melanogaster LD11219p pro...    56   4e-08
BT015296-1|AAT94525.1| 1923|Drosophila melanogaster AT26369p pro...    56   4e-08
AY089600-1|AAL90338.1|  256|Drosophila melanogaster RE19540p pro...    56   4e-08
AF181630-1|AAD55416.1| 1228|Drosophila melanogaster BcDNA.GH0492...    56   4e-08
AF152419-1|AAD38390.1|  411|Drosophila melanogaster WD-40 protei...    56   4e-08
AF117606-1|AAD13113.1|  411|Drosophila melanogaster lissencephal...    56   4e-08
AF098070-1|AAC83821.1|  409|Drosophila melanogaster Lis1 homolog...    56   4e-08
AE013599-2711|AAM68461.1| 1922|Drosophila melanogaster CG30116-P...    56   4e-08
AE013599-2710|AAF57680.2| 1701|Drosophila melanogaster CG30116-P...    56   4e-08
AE013599-2709|AAF57681.2| 1698|Drosophila melanogaster CG30116-P...    56   4e-08
AE013599-2708|AAM68460.1| 1698|Drosophila melanogaster CG30116-P...    56   4e-08
AE013599-2210|AAS64845.1|  411|Drosophila melanogaster CG8440-PF...    56   4e-08
AE013599-2209|AAO41383.1|  411|Drosophila melanogaster CG8440-PE...    56   4e-08
AE013599-2208|AAO41382.1|  411|Drosophila melanogaster CG8440-PD...    56   4e-08
AE013599-2207|AAO41381.1|  411|Drosophila melanogaster CG8440-PC...    56   4e-08
AE013599-2206|AAO41380.1|  411|Drosophila melanogaster CG8440-PB...    56   4e-08
AE013599-2205|AAF58050.1|  411|Drosophila melanogaster CG8440-PA...    56   4e-08
AY069490-1|AAL39635.1|  576|Drosophila melanogaster LD21931p pro...    50   2e-06
AE014297-3088|AAF55949.1|  576|Drosophila melanogaster CG6015-PA...    50   2e-06
AY061388-1|AAL28936.1|  335|Drosophila melanogaster LD31217p pro...    50   3e-06
AE013599-1967|AAF58195.1|  335|Drosophila melanogaster CG12797-P...    50   3e-06
AY089286-1|AAL90024.1|  488|Drosophila melanogaster AT08344p pro...    49   5e-06
AJ012588-1|CAA10070.1|  480|Drosophila melanogaster Notchless pr...    49   5e-06
AE014134-128|AAF51479.2|  488|Drosophila melanogaster CG2863-PA ...    49   5e-06
BT023906-1|ABA81840.1|  914|Drosophila melanogaster GH18655p pro...    49   6e-06
AJ006524-1|CAA07085.1|  914|Drosophila melanogaster coatomer, be...    49   6e-06
AJ006523-1|CAA07084.1|  914|Drosophila melanogaster coatomer, be...    49   6e-06
AE014134-2340|AAF53294.2|  914|Drosophila melanogaster CG6699-PA...    49   6e-06
AY069349-1|AAL39494.1|  391|Drosophila melanogaster LD05671p pro...    47   2e-05
AE014296-2267|AAF49825.1|  391|Drosophila melanogaster CG10191-P...    47   2e-05
AF071881-1|AAC64041.1|  454|Drosophila melanogaster Hira isoform...    46   4e-05
U06460-1|AAC46481.1|  704|Drosophila melanogaster transcription ...    46   6e-05
AY118898-1|AAM50758.1|  510|Drosophila melanogaster LD08669p pro...    46   6e-05
AY051960-1|AAK93384.1|  704|Drosophila melanogaster LD42828p pro...    46   6e-05
AF222924-1|AAF63214.1|  510|Drosophila melanogaster Slimb protein.     46   6e-05
AF222923-1|AAF63213.1|  510|Drosophila melanogaster Slimb protein.     46   6e-05
AF032878-1|AAC38852.1|  510|Drosophila melanogaster Slimb protein.     46   6e-05
AE014297-2934|AAF55853.1|  510|Drosophila melanogaster CG3412-PA...    46   6e-05
AE013599-1190|AAF58737.1|  704|Drosophila melanogaster CG7704-PA...    46   6e-05
BT025112-1|ABE73283.1|  345|Drosophila melanogaster IP10415p pro...    45   7e-05
AE013599-2552|AAF57798.2|  345|Drosophila melanogaster CG10931-P...    45   7e-05
BT016167-1|AAV37052.1| 1047|Drosophila melanogaster AT04626p pro...    45   1e-04
AY069414-1|AAL39559.1|  437|Drosophila melanogaster LD11036p pro...    45   1e-04
AJ222709-1|CAA10954.1| 1047|Drosophila melanogaster HIRA protein.      45   1e-04
AE014298-1052|AAF46267.1| 1047|Drosophila melanogaster CG12153-P...    45   1e-04
BT025218-1|ABF17909.1|  668|Drosophila melanogaster FI01026p pro...    44   1e-04
BT001736-1|AAN71491.1|  668|Drosophila melanogaster RE72568p pro...    44   1e-04
AY089556-1|AAL90294.1|  819|Drosophila melanogaster LD44201p pro...    44   1e-04
AY075425-1|AAL68241.1| 1234|Drosophila melanogaster LD46584p pro...    44   1e-04
AY061311-1|AAL28859.1|  313|Drosophila melanogaster LD23129p pro...    44   1e-04
AJ011114-1|CAA09492.1| 1234|Drosophila melanogaster coatomer alp...    44   1e-04
AF031081-1|AAC48360.1| 1061|Drosophila melanogaster HIRA homolog...    44   1e-04
AE014298-2339|AAF48570.3|  819|Drosophila melanogaster CG13956-P...    44   1e-04
AE014298-2338|AAF48571.2|  819|Drosophila melanogaster CG13956-P...    44   1e-04
AE014298-1349|AAF46509.2|  313|Drosophila melanogaster CG3004-PA...    44   1e-04
AE014296-317|AAF47535.1| 1234|Drosophila melanogaster CG7961-PB,...    44   1e-04
AE014296-316|AAF47534.1| 1234|Drosophila melanogaster CG7961-PA,...    44   1e-04
AE013599-1250|AAM68723.1|  668|Drosophila melanogaster CG9062-PB...    44   1e-04
BT030455-1|ABP87897.1| 1108|Drosophila melanogaster RE64336p pro...    44   2e-04
BT024267-1|ABC86329.1|  604|Drosophila melanogaster IP15590p pro...    44   2e-04
AY075401-1|AAL68231.1| 1326|Drosophila melanogaster LD30271p pro...    44   2e-04
AY061300-1|AAL28848.1| 1326|Drosophila melanogaster LD21322p pro...    44   2e-04
AY058742-1|AAL13971.1|  419|Drosophila melanogaster LP08352p pro...    44   2e-04
AY051546-1|AAK92970.1|  888|Drosophila melanogaster GH19431p pro...    44   2e-04
AE014297-4471|ABI31217.1| 1078|Drosophila melanogaster CG34133-P...    44   2e-04
AE014297-4470|AAN14200.2| 1112|Drosophila melanogaster CG34133-P...    44   2e-04
AE014297-4455|AAF56951.3|  419|Drosophila melanogaster CG31033-P...    44   2e-04
AE014297-4454|AAF56950.3|  445|Drosophila melanogaster CG31033-P...    44   2e-04
AE014297-4453|AAF56952.3|  604|Drosophila melanogaster CG31033-P...    44   2e-04
AE014296-806|AAG22246.1| 1326|Drosophila melanogaster CG15010-PC...    44   2e-04
AE014296-805|AAG22247.1| 1326|Drosophila melanogaster CG15010-PB...    44   2e-04
AE014296-804|AAF47869.1| 1326|Drosophila melanogaster CG15010-PA...    44   2e-04
AY113244-1|AAM29249.1|  308|Drosophila melanogaster AT12460p pro...    44   2e-04
AF132174-1|AAD34762.1|  331|Drosophila melanogaster unknown prot...    44   2e-04
AE014297-1074|AAF54480.1|  331|Drosophila melanogaster CG3909-PA...    44   2e-04
AE014134-2684|AAF53509.2|  308|Drosophila melanogaster CG4935-PA...    44   2e-04
BT003755-1|AAO41419.1|  617|Drosophila melanogaster RE74146p pro...    43   3e-04
AY069513-1|AAL39658.1|  784|Drosophila melanogaster LD23326p pro...    43   3e-04
AL035311-5|CAA22953.1|  784|Drosophila melanogaster EG:52C10.1 p...    43   3e-04
AE013599-2568|AAM68487.1|  617|Drosophila melanogaster CG5033-PB...    43   3e-04
AE013599-2567|AAF57786.1|  784|Drosophila melanogaster CG5033-PA...    43   3e-04
AY094717-1|AAM11070.1|  487|Drosophila melanogaster GH17724p pro...    43   4e-04
AE014297-2520|AAF55555.1|  487|Drosophila melanogaster CG12333-P...    43   4e-04
AY061623-1|AAL29171.1|  553|Drosophila melanogaster SD09427p pro...    42   7e-04
AE014296-2921|AAF49331.1|  553|Drosophila melanogaster CG6322-PA...    42   7e-04
BT004841-1|AAO45197.1|  358|Drosophila melanogaster RH17413p pro...    42   0.001
AF223065-1|AAF34688.1|  823|Drosophila melanogaster putative mic...    42   0.001
AE014298-1137|AAF46336.1|  358|Drosophila melanogaster CG10763-P...    42   0.001
BT023859-1|AAZ86780.1|  316|Drosophila melanogaster IP09508p pro...    41   0.002
BT004480-1|AAO42644.1|  787|Drosophila melanogaster LD47550p pro...    41   0.002
AE013599-943|AAF58888.1|  787|Drosophila melanogaster CG1671-PA ...    41   0.002
AE013599-911|AAF58908.2|  322|Drosophila melanogaster CG10459-PA...    41   0.002
Y14162-1|CAA74575.1|  478|Drosophila melanogaster fizzy-related ...    40   0.002
BT010011-1|AAQ22480.1|  478|Drosophila melanogaster RE20929p pro...    40   0.002
BT001403-1|AAN71158.1|  478|Drosophila melanogaster GH07620p pro...    40   0.002
AY118904-1|AAM50764.1|  743|Drosophila melanogaster LD16387p pro...    40   0.002
AE014298-661|AAN09125.1|  478|Drosophila melanogaster CG3000-PB,...    40   0.002
AE014298-660|AAF45973.1|  478|Drosophila melanogaster CG3000-PA,...    40   0.002
AE014297-3302|AAF56118.1|  743|Drosophila melanogaster CG4448-PA...    40   0.002
AE014134-985|AAF52302.4| 3489|Drosophila melanogaster CG14001-PA...    40   0.003
U62388-1|AAB37257.1|  430|Drosophila melanogaster chromatin asse...    40   0.004
AY061408-1|AAL28956.1|  430|Drosophila melanogaster LD33761p pro...    40   0.004
AM294403-1|CAL26342.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AM294402-1|CAL26341.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AM294401-1|CAL26340.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AM294400-1|CAL26339.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AM294399-1|CAL26338.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AM294398-1|CAL26337.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AM294397-1|CAL26335.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AM294396-1|CAL26330.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AM294395-1|CAL26325.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AM294394-1|CAL26324.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AM294393-1|CAL26323.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AM294392-1|CAL26322.1|  430|Drosophila melanogaster CG4236 protein.    40   0.004
AF146345-1|AAD35017.1|  700|Drosophila melanogaster Ebi protein.       40   0.004
AE014297-1961|AAF55146.1|  430|Drosophila melanogaster CG4236-PA...    40   0.004
AE014134-100|AAF51501.1|  700|Drosophila melanogaster CG4063-PA ...    40   0.004
AY058773-1|AAL14002.1|  787|Drosophila melanogaster SD05646p pro...    39   0.005
AF367178-1|AAK31264.1|  747|Drosophila melanogaster chromatin as...    39   0.005
AF106852-1|AAG21768.1|  787|Drosophila melanogaster phospholipas...    39   0.005
AE014134-219|AAF51402.1|  787|Drosophila melanogaster CG5105-PA ...    39   0.005
AE013599-1108|AAF58788.1|  747|Drosophila melanogaster CG12892-P...    39   0.005
AY118871-1|AAM50731.1|  420|Drosophila melanogaster GM29372p pro...    38   0.011
AY061460-1|AAL29008.1|  730|Drosophila melanogaster LD41760p pro...    38   0.011
AF364305-1|AAK48946.1|  730|Drosophila melanogaster DCKA protein.      38   0.011
AF011332-1|AAD01441.1|  730|Drosophila melanogaster WD-40 family...    38   0.011
AE014134-1952|AAF53009.1|  420|Drosophila melanogaster CG6724-PA...    38   0.011
AE014134-1386|AAN10652.1|  730|Drosophila melanogaster CG7392-PD...    38   0.011
AE014134-1385|AAN10651.1|  730|Drosophila melanogaster CG7392-PC...    38   0.011
AE014134-1384|AAF52594.2|  730|Drosophila melanogaster CG7392-PB...    38   0.011
AE014134-1383|AAF52593.2|  730|Drosophila melanogaster CG7392-PA...    38   0.011
M76593-1|AAA73103.1|  346|Drosophila melanogaster protein ( Dros...    38   0.015
AY118886-1|AAM50746.1|  346|Drosophila melanogaster HL07966p pro...    38   0.015
AF160909-1|AAD46849.2|  386|Drosophila melanogaster LD03471p pro...    38   0.015
AE014297-3318|AAF56128.1|  356|Drosophila melanogaster CG6773-PA...    38   0.015
AE014296-3197|AAF49124.1|  346|Drosophila melanogaster CG8770-PA...    38   0.015
BT022923-1|AAY55339.1|  361|Drosophila melanogaster IP11251p pro...    37   0.019
BT022304-1|AAY54720.1|  364|Drosophila melanogaster IP11351p pro...    37   0.019
BT015954-1|AAV36839.1|  462|Drosophila melanogaster SD11903p pro...    37   0.019
AE014134-2122|AAF53141.1|  462|Drosophila melanogaster CG5202-PA...    37   0.019
M20571-1|AAA28512.1|  719|Drosophila melanogaster protein ( D.me...    36   0.034
BT016114-1|AAV36999.1|  949|Drosophila melanogaster LD10780p pro...    36   0.034
AY118520-1|AAM49889.1|  484|Drosophila melanogaster LD17611p pro...    36   0.034
AY061000-1|AAL28548.1|  328|Drosophila melanogaster HL01517p pro...    36   0.034
AY052019-1|AAK93443.1|  794|Drosophila melanogaster LD47515p pro...    36   0.034
AY051929-1|AAK93353.1|  509|Drosophila melanogaster LD41216p pro...    36   0.034
AF346730-1|AAK50884.1|  942|Drosophila melanogaster cannonball p...    36   0.034
AF145695-1|AAD38670.1|  719|Drosophila melanogaster BcDNA.LD3382...    36   0.034
AE014297-3908|AAN14069.1|  719|Drosophila melanogaster CG8384-PD...    36   0.034
AE014297-3907|AAN14068.1|  719|Drosophila melanogaster CG8384-PC...    36   0.034
AE014297-3906|AAF56556.1|  719|Drosophila melanogaster CG8384-PB...    36   0.034
AE014297-3905|AAF56557.1|  719|Drosophila melanogaster CG8384-PA...    36   0.034
AE014297-3904|AAS65218.1|  730|Drosophila melanogaster CG8384-PE...    36   0.034
AE014297-2605|AAF55614.2|  509|Drosophila melanogaster CG5451-PA...    36   0.034
AE014296-1810|AAF50162.1|  942|Drosophila melanogaster CG6577-PA...    36   0.034
AE013599-3624|AAF47023.1|  328|Drosophila melanogaster CG3957-PA...    36   0.034
AE013599-1970|AAX52704.1|  484|Drosophila melanogaster CG33505-P...    36   0.034
AE013599-1182|AAF58744.1|  949|Drosophila melanogaster CG12325-P...    36   0.034
AE013599-1156|AAF58765.2|  794|Drosophila melanogaster CG11887-P...    36   0.034
AY118857-1|AAM50717.1|  320|Drosophila melanogaster GM21396p pro...    36   0.045
AY118568-1|AAM49937.2|  360|Drosophila melanogaster LD40776p pro...    36   0.045
AJ556819-1|CAD89224.1|  320|Drosophila melanogaster Tex protein ...    36   0.045
AE014297-4400|AAF56906.1|  436|Drosophila melanogaster CG7568-PA...    36   0.045
AE014297-731|AAF54217.1|  320|Drosophila melanogaster CG9615-PA ...    36   0.045
AE013599-3245|AAF46745.1|  346|Drosophila melanogaster CG9862-PA...    36   0.045
BT011095-1|AAR82761.1|  398|Drosophila melanogaster RE32047p pro...    35   0.078
AE013599-3730|AAF47100.1|  348|Drosophila melanogaster CG2812-PA...    35   0.078
U22419-1|AAA83150.1|  526|Drosophila melanogaster fzy protein.         35   0.10 
BT029432-1|ABK57089.1|  526|Drosophila melanogaster LD44795p pro...    35   0.10 
BT010249-1|AAQ23567.1|  526|Drosophila melanogaster RE39287p pro...    35   0.10 
AE014298-868|AAF46145.1|  424|Drosophila melanogaster CG15897-PA...    35   0.10 
AE014134-2699|AAF53523.1|  526|Drosophila melanogaster CG4274-PA...    35   0.10 
AY118560-1|AAM49929.1|  528|Drosophila melanogaster LD37992p pro...    34   0.14 
AY069081-1|AAL39226.1|  317|Drosophila melanogaster GH09638p pro...    34   0.14 
AF467271-1|AAM74566.1|  528|Drosophila melanogaster coronin prot...    34   0.14 
AE014134-1477|AAF52654.1|  317|Drosophila melanogaster CG17293-P...    34   0.14 
AE013599-240|AAS64781.1|  528|Drosophila melanogaster CG9446-PC,...    34   0.14 
AE013599-239|AAM70835.1|  528|Drosophila melanogaster CG9446-PB,...    34   0.14 
AE013599-238|AAF57403.1|  528|Drosophila melanogaster CG9446-PA,...    34   0.14 
M22567-1|AAB59247.1|  340|Drosophila melanogaster guanine nucleo...    34   0.18 
AY058566-1|AAL13795.1|  340|Drosophila melanogaster LD25526p pro...    34   0.18 
AE014298-2263|AAS65363.1|  340|Drosophila melanogaster CG10545-P...    34   0.18 
AE014298-2262|AAS65362.1|  340|Drosophila melanogaster CG10545-P...    34   0.18 
AE014298-2261|AAS65361.1|  340|Drosophila melanogaster CG10545-P...    34   0.18 
AE014298-2260|AAS65360.1|  340|Drosophila melanogaster CG10545-P...    34   0.18 
AE014298-2259|AAN09370.1|  340|Drosophila melanogaster CG10545-P...    34   0.18 
AE014298-2258|AAF48530.1|  340|Drosophila melanogaster CG10545-P...    34   0.18 
AE014296-1503|AAF50379.1|  339|Drosophila melanogaster CG6486-PA...    34   0.18 
Y18278-2|CAC18800.1| 3347|Drosophila melanogaster AKAP550 protein.     33   0.24 
Y18278-1|CAC18799.1| 3554|Drosophila melanogaster AKAP550 protein.     33   0.24 
AY069717-1|AAL39862.1|  630|Drosophila melanogaster LP01609p pro...    33   0.24 
AY051596-1|AAK93020.1|  969|Drosophila melanogaster GH23814p pro...    33   0.24 
AE014298-711|AAN09135.1| 3522|Drosophila melanogaster CG6775-PB,...    33   0.24 
AE014298-710|AAF46011.2| 3584|Drosophila melanogaster CG6775-PA,...    33   0.24 
AE014298-705|ABI30968.1| 3719|Drosophila melanogaster CG6775-PC,...    33   0.24 
AE014296-3563|AAN12175.1|  630|Drosophila melanogaster CG7611-PH...    33   0.24 
AE014296-3562|AAN12174.1|  630|Drosophila melanogaster CG7611-PG...    33   0.24 
AE014296-3561|AAN12173.1|  630|Drosophila melanogaster CG7611-PF...    33   0.24 
AE014296-3560|AAN12172.1|  630|Drosophila melanogaster CG7611-PE...    33   0.24 
AE014296-3559|AAG22181.1|  630|Drosophila melanogaster CG7611-PD...    33   0.24 
AE014296-3558|AAG22182.2|  630|Drosophila melanogaster CG7611-PC...    33   0.24 
AE014296-3557|AAG22180.1|  630|Drosophila melanogaster CG7611-PB...    33   0.24 
AE014296-3556|AAF51739.2|  630|Drosophila melanogaster CG7611-PA...    33   0.24 
AE014296-796|AAF47865.2|  878|Drosophila melanogaster CG1332-PA ...    33   0.24 
U90930-1|AAB53431.1|  326|Drosophila melanogaster TRIP-1 homolog...    33   0.32 
BT016079-1|AAV36964.1|  922|Drosophila melanogaster LD47749p pro...    33   0.32 
AY118891-1|AAM50751.1| 1508|Drosophila melanogaster LD01189p pro...    33   0.32 
AY118759-1|AAM50619.1|  656|Drosophila melanogaster GH09073p pro...    33   0.32 
AY118527-1|AAM49896.1|  326|Drosophila melanogaster LD24026p pro...    33   0.32 
AY058590-1|AAL13819.1|  446|Drosophila melanogaster LD28275p pro...    33   0.32 
AY052114-1|AAK93538.1|  922|Drosophila melanogaster SD06427p pro...    33   0.32 
AY052025-1|AAK93449.1| 1183|Drosophila melanogaster LD47622p pro...    33   0.32 
AE014297-1680|AAF54941.1|  922|Drosophila melanogaster CG9799-PA...    33   0.32 
AE014296-2508|AAF49638.2|  446|Drosophila melanogaster CG7275-PA...    33   0.32 
AE014134-1040|AAF52336.2|  656|Drosophila melanogaster CG9144-PA...    33   0.32 
AE014134-821|AAF52183.1|  326|Drosophila melanogaster CG8882-PA ...    33   0.32 
AE014134-313|ABI31283.1| 1504|Drosophila melanogaster CG7337-PB,...    33   0.32 
AE014134-312|ABI31282.1| 2347|Drosophila melanogaster CG7337-PC,...    33   0.32 
AE014134-311|AAF51327.2| 1508|Drosophila melanogaster CG7337-PA,...    33   0.32 
AY118526-1|AAM49895.1|  323|Drosophila melanogaster LD23540p pro...    33   0.42 
AY071120-1|AAL48742.1|  489|Drosophila melanogaster RE17089p pro...    33   0.42 
AF160906-1|AAD46846.1|  505|Drosophila melanogaster BcDNA.LD0279...    33   0.42 
AF088846-1|AAD44035.1|  327|Drosophila melanogaster mitotic chec...    33   0.42 
AF075594-1|AAD13398.1|  327|Drosophila melanogaster mitotic chec...    33   0.42 
AE014297-4409|AAF56914.1|  326|Drosophila melanogaster CG7581-PA...    33   0.42 
AE014296-3329|AAF51573.2|  489|Drosophila melanogaster CG5585-PA...    33   0.42 
AE013599-2704|AAF57684.1|  505|Drosophila melanogaster CG5519-PA...    33   0.42 
AY061340-1|AAL28888.1|  608|Drosophila melanogaster LD27045p pro...    32   0.55 
AF106679-1|AAD21971.1|  326|Drosophila melanogaster WD-40 repeat...    32   0.55 
AE014296-2271|AAN11835.1|  604|Drosophila melanogaster CG10724-P...    32   0.55 
AE014296-2270|AAF49822.1|  608|Drosophila melanogaster CG10724-P...    32   0.55 
AE014134-2026|AAS64677.1|  969|Drosophila melanogaster CG4705-PB...    32   0.55 
AE014134-2025|AAF53065.2|  989|Drosophila melanogaster CG4705-PA...    32   0.55 
AY075228-1|AAL68095.1|  511|Drosophila melanogaster AT18160p pro...    32   0.73 
AY051986-1|AAK93410.1|  613|Drosophila melanogaster LD45447p pro...    32   0.73 
AE014297-4270|AAF56817.1|  621|Drosophila melanogaster CG1523-PA...    32   0.73 
AE014297-3524|AAF56278.2| 2232|Drosophila melanogaster CG31132-P...    32   0.73 
AE013599-3043|AAM68392.1|  511|Drosophila melanogaster CG9945-PB...    32   0.73 
AE013599-3042|AAF57446.2|  511|Drosophila melanogaster CG9945-PA...    32   0.73 
AY047497-1|AAK77229.1|  922|Drosophila melanogaster GH01043p pro...    31   0.97 
AE014297-2490|AAF55529.1|  922|Drosophila melanogaster CG8064-PA...    31   0.97 
L41867-1|AAA86427.1|  425|Drosophila melanogaster extra sex comb...    31   1.3  
AY089281-1|AAL90019.1|  336|Drosophila melanogaster AT07829p pro...    31   1.3  
AY075465-1|AAL68278.1|  459|Drosophila melanogaster RE21021p pro...    31   1.3  
AY069796-1|AAL39941.1|  425|Drosophila melanogaster SD03549p pro...    31   1.3  
AY069659-1|AAL39804.1|  535|Drosophila melanogaster LD43561p pro...    31   1.3  
AL009196-1|CAA15709.1|  535|Drosophila melanogaster EG:25E8.3 pr...    31   1.3  
AE014298-375|AAF45765.1|  535|Drosophila melanogaster CG3071-PA ...    31   1.3  
AE014134-2101|AAF53124.1|  425|Drosophila melanogaster CG14941-P...    31   1.3  
AE013599-3562|AAF46973.1|  336|Drosophila melanogaster CG12782-P...    31   1.3  
AE013599-1189|AAF58738.1|  459|Drosophila melanogaster CG6751-PA...    31   1.3  
AY128462-1|AAM75055.1|  456|Drosophila melanogaster RE17371p pro...    31   1.7  
AY119263-1|AAM51123.1|  232|Drosophila melanogaster SD23366p pro...    31   1.7  
AY071477-1|AAL49099.1|  456|Drosophila melanogaster RE55020p pro...    31   1.7  
AF441759-1|AAM20923.1| 1276|Drosophila melanogaster ER-golgi esc...    31   1.7  
AE014297-4816|AAF57203.2|  644|Drosophila melanogaster CG2112-PA...    31   1.7  
AE013599-134|AAF57291.3| 1276|Drosophila melanogaster CG33131-PA...    31   1.7  
AE013599-104|AAF57313.3|  456|Drosophila melanogaster CG12792-PA...    31   1.7  
AY094738-1|AAM11091.1|  743|Drosophila melanogaster GH28796p pro...    30   2.2  
AY061326-1|AAL28874.1|  524|Drosophila melanogaster LD24373p pro...    30   2.2  
AY051695-1|AAK93119.1|  807|Drosophila melanogaster LD24014p pro...    30   2.2  
AE014297-325|AAN13257.1|  807|Drosophila melanogaster CG1109-PB,...    30   2.2  
AE014297-324|AAF51974.2|  807|Drosophila melanogaster CG1109-PA,...    30   2.2  
AE014296-350|AAF47563.1|  748|Drosophila melanogaster CG8001-PA ...    30   2.2  
X98094-4|CAA66723.1|  758|Drosophila melanogaster l(2)dlt protein.     29   3.9  
X83414-1|CAA58441.1|  758|Drosophila melanogaster lethal(2)denti...    29   3.9  
AY121647-1|AAM51974.1|  769|Drosophila melanogaster LD21681p pro...    29   3.9  
AE014134-3194|AAF53868.1|  367|Drosophila melanogaster CG10728-P...    29   3.9  
AE013599-3670|AAF47049.1|  769|Drosophila melanogaster CG11295-P...    29   3.9  
BT021965-1|AAX94786.1| 1953|Drosophila melanogaster GH12955p pro...    29   5.1  
BT012297-1|AAS77422.1|  320|Drosophila melanogaster SD22926p pro...    29   5.1  
AY051537-1|AAK92961.1|  451|Drosophila melanogaster GH18995p pro...    29   5.1  
AE014297-3748|AAF56429.1|  320|Drosophila melanogaster CG11875-P...    29   5.1  
AE014134-2132|AAF53146.1| 1953|Drosophila melanogaster CG6734-PA...    29   5.1  
AE013599-3746|AAF47111.1|  451|Drosophila melanogaster CG16783-P...    29   5.1  
AY094647-1|AAM11000.1|  367|Drosophila melanogaster AT09449p pro...    29   6.8  
AY060895-1|AAL28443.1|  367|Drosophila melanogaster GM04727p pro...    29   6.8  
Y14366-1|CAA74736.1|  433|Drosophila melanogaster lipase 1 protein.    28   9.0  
BT030286-1|ABN49425.1|  649|Drosophila melanogaster IP18554p pro...    28   9.0  
BT003254-1|AAO25011.1| 1074|Drosophila melanogaster LD25748p pro...    28   9.0  
BT003207-1|AAO24962.1|  439|Drosophila melanogaster SD23516p pro...    28   9.0  
BT001648-1|AAN71403.1|  439|Drosophila melanogaster RE43539p pro...    28   9.0  
BT001529-1|AAN71284.1|  481|Drosophila melanogaster RE05782p pro...    28   9.0  
AY095054-1|AAM11382.1|  609|Drosophila melanogaster LD41718p pro...    28   9.0  
AY075506-1|AAL68315.1|  439|Drosophila melanogaster RE54405p pro...    28   9.0  
AY069679-1|AAL39824.1|  489|Drosophila melanogaster LD45254p pro...    28   9.0  
AF161748-1|AAD45752.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161747-1|AAD45751.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161746-1|AAD45750.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161745-1|AAD45749.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161744-1|AAD45748.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161743-1|AAD45747.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161742-1|AAD45746.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161741-1|AAD45745.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161740-1|AAD45744.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161739-1|AAD45743.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161738-1|AAD45742.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161737-1|AAD45741.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161736-1|AAD45740.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161735-1|AAD45739.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161734-1|AAD45738.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161733-1|AAD45737.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161732-1|AAD45736.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161731-1|AAD45735.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161730-1|AAD45734.1|  309|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161729-1|AAD45733.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161728-1|AAD45732.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161727-1|AAD45731.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161726-1|AAD45730.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161725-1|AAD45729.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161724-1|AAD45728.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF161723-1|AAD45727.1|  310|Drosophila melanogaster anon1A3 prot...    28   9.0  
AF005843-1|AAB81476.1|  341|Drosophila melanogaster anon1A3 prot...    28   9.0  
AE014298-1126|AAF46323.1|  609|Drosophila melanogaster CG2260-PA...    28   9.0  
AE014298-958|AAN09188.1| 1074|Drosophila melanogaster CG4532-PE,...    28   9.0  
AE014298-957|AAF46202.1| 1074|Drosophila melanogaster CG4532-PD,...    28   9.0  
AE014298-956|AAN09187.1| 1074|Drosophila melanogaster CG4532-PC,...    28   9.0  
AE014298-955|AAN09186.1| 1074|Drosophila melanogaster CG4532-PB,...    28   9.0  
AE014298-954|AAN09185.1| 1074|Drosophila melanogaster CG4532-PA,...    28   9.0  
AE014297-4801|AAN14289.1|  439|Drosophila melanogaster CG1910-PD...    28   9.0  
AE014297-4800|AAN14288.1|  439|Drosophila melanogaster CG1910-PB...    28   9.0  
AE014297-4799|AAN14287.1|  466|Drosophila melanogaster CG1910-PC...    28   9.0  
AE014297-4798|AAF57190.1|  489|Drosophila melanogaster CG1910-PA...    28   9.0  
AE014134-1935|AAF52994.1|  439|Drosophila melanogaster CG7279-PA...    28   9.0  

>AY071661-1|AAL49283.1|  318|Drosophila melanogaster RE74715p
           protein.
          Length = 318

 Score =  206 bits (503), Expect = 2e-53
 Identities = 96/107 (89%), Positives = 101/107 (94%), Gaps = 1/107 (0%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN-NYGIPQKRL 217
           MSETL+LRGTL GHNGWVTQIATNPK PD I+S+SRDKTLIVWKLTRDE+ NYG PQKRL
Sbjct: 1   MSETLQLRGTLIGHNGWVTQIATNPKDPDTIISASRDKTLIVWKLTRDEDTNYGYPQKRL 60

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           YGHSHFISDVVLSSDGNYALSGSWD+TLRLWDLAAGKTTRRFE HTK
Sbjct: 61  YGHSHFISDVVLSSDGNYALSGSWDQTLRLWDLAAGKTTRRFEGHTK 107



 Score = 52.0 bits (119), Expect = 6e-07
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 3/93 (3%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLT--RDENNYGIPQKRLYGHSHFISDV 247
           GH  WV+ +  +P + + +I+S   D+T+ VW L   + +NN+       +GH+ +++ V
Sbjct: 147 GHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNLANCKLKNNH-------HGHNGYLNTV 199

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            +S DG+   SG  D    LWDL  GK     E
Sbjct: 200 TVSPDGSLCTSGGKDSKALLWDLNDGKNLYTLE 232



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +++ +  +    +  LS S D+TL +W L       G   +R  GH+  +  V 
Sbjct: 60  LYGHSHFISDVVLSSD-GNYALSGSWDQTLRLWDLAA-----GKTTRRFEGHTKDVLSVA 113

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHT 355
            S+D    +SGS DKT++LW+ LA  K T + + HT
Sbjct: 114 FSADNRQIVSGSRDKTIKLWNTLAECKFTIQEDGHT 149



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 24/92 (26%), Positives = 45/92 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL+    GHNG++  +  +P    +  S  +D   ++W L   +N Y +       H+  
Sbjct: 184 KLKNNHHGHNGYLNTVTVSPD-GSLCTSGGKDSKALLWDLNDGKNLYTLE------HNDI 236

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           I+ +  S +  Y L  ++  ++++WDLA  KT
Sbjct: 237 INALCFSPN-RYWLCVAYGPSIKIWDLACKKT 267



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL--SGSWDKTLR 304
           I+S SRDKT+ +W  T  E  + I +    GH+ ++S V  S + +  +  S  WD+T++
Sbjct: 121 IVSGSRDKTIKLWN-TLAECKFTIQED---GHTDWVSCVRFSPNHSNPIIVSCGWDRTVK 176

Query: 305 LWDLAAGKTTRRFEDH 352
           +W+LA  K       H
Sbjct: 177 VWNLANCKLKNNHHGH 192


>AE014134-1351|AAF52566.1|  318|Drosophila melanogaster CG7111-PA
           protein.
          Length = 318

 Score =  206 bits (503), Expect = 2e-53
 Identities = 96/107 (89%), Positives = 101/107 (94%), Gaps = 1/107 (0%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN-NYGIPQKRL 217
           MSETL+LRGTL GHNGWVTQIATNPK PD I+S+SRDKTLIVWKLTRDE+ NYG PQKRL
Sbjct: 1   MSETLQLRGTLIGHNGWVTQIATNPKDPDTIISASRDKTLIVWKLTRDEDTNYGYPQKRL 60

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           YGHSHFISDVVLSSDGNYALSGSWD+TLRLWDLAAGKTTRRFE HTK
Sbjct: 61  YGHSHFISDVVLSSDGNYALSGSWDQTLRLWDLAAGKTTRRFEGHTK 107



 Score = 52.0 bits (119), Expect = 6e-07
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 3/93 (3%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLT--RDENNYGIPQKRLYGHSHFISDV 247
           GH  WV+ +  +P + + +I+S   D+T+ VW L   + +NN+       +GH+ +++ V
Sbjct: 147 GHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNLANCKLKNNH-------HGHNGYLNTV 199

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            +S DG+   SG  D    LWDL  GK     E
Sbjct: 200 TVSPDGSLCTSGGKDSKALLWDLNDGKNLYTLE 232



 Score = 49.6 bits (113), Expect = 3e-06
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +++ +  +    +  LS S D+TL +W L       G   +R  GH+  +  V 
Sbjct: 60  LYGHSHFISDVVLSSD-GNYALSGSWDQTLRLWDLAA-----GKTTRRFEGHTKDVLSVA 113

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHT 355
            S+D    +SGS DKT++LW+ LA  K T + + HT
Sbjct: 114 FSADNRQIVSGSRDKTIKLWNTLAECKFTIQEDGHT 149



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 24/92 (26%), Positives = 45/92 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL+    GHNG++  +  +P    +  S  +D   ++W L   +N Y +       H+  
Sbjct: 184 KLKNNHHGHNGYLNTVTVSPD-GSLCTSGGKDSKALLWDLNDGKNLYTLE------HNDI 236

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           I+ +  S +  Y L  ++  ++++WDLA  KT
Sbjct: 237 INALCFSPN-RYWLCVAYGPSIKIWDLACKKT 267



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL--SGSWDKTLR 304
           I+S SRDKT+ +W  T  E  + I +    GH+ ++S V  S + +  +  S  WD+T++
Sbjct: 121 IVSGSRDKTIKLWN-TLAECKFTIQED---GHTDWVSCVRFSPNHSNPIIVSCGWDRTVK 176

Query: 305 LWDLAAGKTTRRFEDH 352
           +W+LA  K       H
Sbjct: 177 VWNLANCKLKNNHHGH 192


>U96491-1|AAB72148.1|  318|Drosophila melanogaster RACK1 protein.
          Length = 318

 Score =  206 bits (502), Expect = 2e-53
 Identities = 96/107 (89%), Positives = 101/107 (94%), Gaps = 1/107 (0%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN-NYGIPQKRL 217
           MSETL+LRGTL GHNGWVTQIATNPK PD I+S+SRDKTLIVWKLTRDE+ NYG PQKRL
Sbjct: 1   MSETLQLRGTLIGHNGWVTQIATNPKDPDTIISASRDKTLIVWKLTRDEDTNYGYPQKRL 60

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           YGHSHFISDVVLSSDGNYALSGSWD+TLRLWDLAAGKTTRRFE HTK
Sbjct: 61  YGHSHFISDVVLSSDGNYALSGSWDQTLRLWDLAAGKTTRRFERHTK 107



 Score = 52.0 bits (119), Expect = 6e-07
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 3/93 (3%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPD-MILSSSRDKTLIVWKLT--RDENNYGIPQKRLYGHSHFISDV 247
           GH  WV+ +  +P + + +I+S   D+T+ VW L   + +NN+       +GH+ +++ V
Sbjct: 147 GHTDWVSCVRFSPNHSNPIIVSCGWDRTVKVWNLANCKLKNNH-------HGHNGYLNTV 199

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            +S DG+   SG  D    LWDL  GK     E
Sbjct: 200 TVSPDGSLCTSGGKDSKALLWDLNDGKNLYTLE 232



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +++ +  +    +  LS S D+TL +W L       G   +R   H+  +  V 
Sbjct: 60  LYGHSHFISDVVLSSD-GNYALSGSWDQTLRLWDLAA-----GKTTRRFERHTKDVLSVA 113

Query: 251 LSSDGNYALSGSWDKTLRLWD-LAAGKTTRRFEDHT 355
            S+D    +SGS DKT++LW+ LA  K T + + HT
Sbjct: 114 FSADNRQIVSGSRDKTIKLWNTLAECKFTIQEDGHT 149



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 24/92 (26%), Positives = 45/92 (48%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL+    GHNG++  +  +P    +  S  +D   ++W L   +N Y +       H+  
Sbjct: 184 KLKNNHHGHNGYLNTVTVSPD-GSLCTSGGKDSKALLWDLNDGKNLYTLE------HNDI 236

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           I+ +  S +  Y L  ++  ++++WDLA  KT
Sbjct: 237 INALCFSPN-RYWLCVAYGPSIKIWDLACKKT 267



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYAL--SGSWDKTLR 304
           I+S SRDKT+ +W  T  E  + I +    GH+ ++S V  S + +  +  S  WD+T++
Sbjct: 121 IVSGSRDKTIKLWN-TLAECKFTIQED---GHTDWVSCVRFSPNHSNPIIVSCGWDRTVK 176

Query: 305 LWDLAAGKTTRRFEDH 352
           +W+LA  K       H
Sbjct: 177 VWNLANCKLKNNHHGH 192


>AY118386-1|AAM48415.1|  361|Drosophila melanogaster RE31658p
           protein.
          Length = 361

 Score = 62.5 bits (145), Expect = 5e-10
 Identities = 39/118 (33%), Positives = 61/118 (51%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           +S  S+  K    +     L+ TL GH   V+ +  +P   + + SSS DK + +W    
Sbjct: 45  SSNSSASNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPN-GEWLASSSADKLIKIWGAYD 103

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                G  +K + GH   ISDV  SSD    +SGS DKTL++W+L+ GK+ +  + H+
Sbjct: 104 -----GKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHS 156



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 31/100 (31%), Positives = 54/100 (54%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   T+ GH   ++ +A +     +++S S DKTL VW+L+      G   K L GHS++
Sbjct: 105 KFEKTISGHKLGISDVAWSSD-SRLLVSGSDDKTLKVWELST-----GKSLKTLKGHSNY 158

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+++R+WD+  GK  +    H+
Sbjct: 159 VFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHS 198



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   TL  H+  V+ +  N +   +I+SSS D    +W     +   G   K L    
Sbjct: 187 TGKCLKTLPAHSDPVSAVHFN-RDGSLIVSSSYDGLCRIW-----DTASGQCLKTLIDDD 240

Query: 230 HF-ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  +S V  S +G Y L+ + D TL+LWD + GK  + +  H
Sbjct: 241 NPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 282



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 3/89 (3%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS---SDGN 268
           + + N KY   IL+++ D TL +W  ++     G   K   GH +    +  +   + G 
Sbjct: 248 KFSPNGKY---ILAATLDNTLKLWDYSK-----GKCLKTYTGHKNEKYCIFANFSVTGGK 299

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + +SGS D  + +W+L + +  ++ + HT
Sbjct: 300 WIVSGSEDNMVYIWNLQSKEVVQKLQGHT 328


>AL138972-9|CAB72292.1|  361|Drosophila melanogaster EG:BACR25B3.7
           protein.
          Length = 361

 Score = 62.5 bits (145), Expect = 5e-10
 Identities = 39/118 (33%), Positives = 61/118 (51%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           +S  S+  K    +     L+ TL GH   V+ +  +P   + + SSS DK + +W    
Sbjct: 45  SSNSSASNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPN-GEWLASSSADKLIKIWGAYD 103

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                G  +K + GH   ISDV  SSD    +SGS DKTL++W+L+ GK+ +  + H+
Sbjct: 104 -----GKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHS 156



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 31/100 (31%), Positives = 54/100 (54%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   T+ GH   ++ +A +     +++S S DKTL VW+L+      G   K L GHS++
Sbjct: 105 KFEKTISGHKLGISDVAWSSD-SRLLVSGSDDKTLKVWELST-----GKSLKTLKGHSNY 158

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+++R+WD+  GK  +    H+
Sbjct: 159 VFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHS 198



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   TL  H+  V+ +  N +   +I+SSS D    +W     +   G   K L    
Sbjct: 187 TGKCLKTLPAHSDPVSAVHFN-RDGSLIVSSSYDGLCRIW-----DTASGQCLKTLIDDD 240

Query: 230 HF-ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  +S V  S +G Y L+ + D TL+LWD + GK  + +  H
Sbjct: 241 NPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 282



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 3/89 (3%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS---SDGN 268
           + + N KY   IL+++ D TL +W  ++     G   K   GH +    +  +   + G 
Sbjct: 248 KFSPNGKY---ILAATLDNTLKLWDYSK-----GKCLKTYTGHKNEKYCIFANFSVTGGK 299

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + +SGS D  + +W+L + +  ++ + HT
Sbjct: 300 WIVSGSEDNMVYIWNLQSKEVVQKLQGHT 328


>AF233288-1|AAF43418.1|  361|Drosophila melanogaster WDS protein.
          Length = 361

 Score = 62.5 bits (145), Expect = 5e-10
 Identities = 39/118 (33%), Positives = 61/118 (51%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           +S  S+  K    +     L+ TL GH   V+ +  +P   + + SSS DK + +W    
Sbjct: 45  SSNSSASNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPN-GEWLASSSADKLIKIWGAYD 103

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                G  +K + GH   ISDV  SSD    +SGS DKTL++W+L+ GK+ +  + H+
Sbjct: 104 -----GKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHS 156



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 31/100 (31%), Positives = 54/100 (54%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   T+ GH   ++ +A +     +++S S DKTL VW+L+      G   K L GHS++
Sbjct: 105 KFEKTISGHKLGISDVAWSSD-SRLLVSGSDDKTLKVWELST-----GKSLKTLKGHSNY 158

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+++R+WD+  GK  +    H+
Sbjct: 159 VFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHS 198



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   TL  H+  V+ +  N +   +I+SSS D    +W     +   G   K L    
Sbjct: 187 TGKCLKTLPAHSDPVSAVHFN-RDGSLIVSSSYDGLCRIW-----DTASGQCLKTLIDDD 240

Query: 230 HF-ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  +S V  S +G Y L+ + D TL+LWD + GK  + +  H
Sbjct: 241 NPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 282



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 3/89 (3%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS---SDGN 268
           + + N KY   IL+++ D TL +W  ++     G   K   GH +    +  +   + G 
Sbjct: 248 KFSPNGKY---ILAATLDNTLKLWDYSK-----GKCLKTYTGHKNEKYCIFANFSVTGGK 299

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + +SGS D  + +W+L + +  ++ + HT
Sbjct: 300 WIVSGSEDNMVYIWNLQSKEVVQKLQGHT 328


>AE014298-414|AAF45791.1|  361|Drosophila melanogaster CG17437-PA
           protein.
          Length = 361

 Score = 62.5 bits (145), Expect = 5e-10
 Identities = 39/118 (33%), Positives = 61/118 (51%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           +S  S+  K    +     L+ TL GH   V+ +  +P   + + SSS DK + +W    
Sbjct: 45  SSNSSASNKSSLSVKPNYTLKFTLAGHTKAVSAVKFSPN-GEWLASSSADKLIKIWGAYD 103

Query: 182 DENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                G  +K + GH   ISDV  SSD    +SGS DKTL++W+L+ GK+ +  + H+
Sbjct: 104 -----GKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHS 156



 Score = 56.8 bits (131), Expect = 2e-08
 Identities = 31/100 (31%), Positives = 54/100 (54%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K   T+ GH   ++ +A +     +++S S DKTL VW+L+      G   K L GHS++
Sbjct: 105 KFEKTISGHKLGISDVAWSSD-SRLLVSGSDDKTLKVWELST-----GKSLKTLKGHSNY 158

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +     +   N  +SGS+D+++R+WD+  GK  +    H+
Sbjct: 159 VFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHS 198



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 31/102 (30%), Positives = 48/102 (47%), Gaps = 1/102 (0%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           T K   TL  H+  V+ +  N +   +I+SSS D    +W     +   G   K L    
Sbjct: 187 TGKCLKTLPAHSDPVSAVHFN-RDGSLIVSSSYDGLCRIW-----DTASGQCLKTLIDDD 240

Query: 230 HF-ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  +S V  S +G Y L+ + D TL+LWD + GK  + +  H
Sbjct: 241 NPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 282



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 3/89 (3%)
 Frame = +2

Query: 98  QIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS---SDGN 268
           + + N KY   IL+++ D TL +W  ++     G   K   GH +    +  +   + G 
Sbjct: 248 KFSPNGKY---ILAATLDNTLKLWDYSK-----GKCLKTYTGHKNEKYCIFANFSVTGGK 299

Query: 269 YALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + +SGS D  + +W+L + +  ++ + HT
Sbjct: 300 WIVSGSEDNMVYIWNLQSKEVVQKLQGHT 328


>AY070530-1|AAL48001.1|  347|Drosophila melanogaster GM13767p
           protein.
          Length = 347

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 30/94 (31%), Positives = 51/94 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G +     +P+  +++LSS  D+ + +W++  D  N       + GHS  + +  
Sbjct: 51  LEGHEGEIFTAEFHPE-GELLLSSGFDRQIYIWQVYEDCENV----MAMSGHSGAVMEAH 105

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + DG++  + S DKTL  WD+A G+  RRF+ H
Sbjct: 106 FTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGH 139



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH+G V +    P     I + S DKTL  W +   +      Q+R  GH +F++ V 
Sbjct: 94  MSGHSGAVMEAHFTPD-GSHIFTCSTDKTLAFWDIATGQR-----QRRFKGHGNFVNSVQ 147

Query: 251 LSSDGNYAL-SGSWDKTLRLWD 313
            S  G   L SGS D+T+++WD
Sbjct: 148 GSRRGQQLLCSGSDDRTIKIWD 169



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/64 (28%), Positives = 35/64 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + ++S   D  + +W + +    +      L GHS  I+ + LS +G++ L+ + D TLR
Sbjct: 195 EQVISGGIDNEVKIWDIRKQAVLH-----HLRGHSDTITGMSLSPEGDFILTNAMDNTLR 249

Query: 305 LWDL 316
           +WD+
Sbjct: 250 VWDV 253



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 21/84 (25%), Positives = 37/84 (44%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           GT R +N  +          D++  ++RDK L+   + R  +N   P  +L GH   I  
Sbjct: 2   GTKRPNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRT-SNLQAPIMQLEGHEGEIFT 60

Query: 245 VVLSSDGNYALSGSWDKTLRLWDL 316
                +G   LS  +D+ + +W +
Sbjct: 61  AEFHPEGELLLSSGFDRQIYIWQV 84



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/42 (42%), Positives = 26/42 (61%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           T ++   L GHNG V  +  +PK P +ILS S DKTL + ++
Sbjct: 305 TRRILYKLPGHNGSVNAVDFSPKEP-LILSGSSDKTLYLGEI 345



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 18/95 (18%), Positives = 39/95 (41%), Gaps = 1/95 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF-ISDVV 250
           +GH  +V  +  + +   ++ S S D+T+ +W   +    + +        S F ++ V 
Sbjct: 137 KGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTL-------ESPFQVTAVC 189

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               G   +SG  D  +++WD+           H+
Sbjct: 190 FGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHS 224



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 21/64 (32%), Positives = 31/64 (48%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I S S D+ + +W +      Y +P     GH+  ++ V  S      LSGS DKTL 
Sbjct: 287 DKITSGSADRHVYIWDVNTRRILYKLP-----GHNGSVNAVDFSPKEPLILSGSSDKTLY 341

Query: 305 LWDL 316
           L ++
Sbjct: 342 LGEI 345


>AE014134-53|AAF51536.1|  347|Drosophila melanogaster CG3436-PA,
           isoform A protein.
          Length = 347

 Score = 59.7 bits (138), Expect = 3e-09
 Identities = 30/94 (31%), Positives = 51/94 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G +     +P+  +++LSS  D+ + +W++  D  N       + GHS  + +  
Sbjct: 51  LEGHEGEIFTAEFHPE-GELLLSSGFDRQIYIWQVYEDCENV----MAMSGHSGAVMEAH 105

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + DG++  + S DKTL  WD+A G+  RRF+ H
Sbjct: 106 FTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGH 139



 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH+G V +    P     I + S DKTL  W +   +      Q+R  GH +F++ V 
Sbjct: 94  MSGHSGAVMEAHFTPD-GSHIFTCSTDKTLAFWDIATGQR-----QRRFKGHGNFVNSVQ 147

Query: 251 LSSDGNYAL-SGSWDKTLRLWD 313
            S  G   L SGS D+T+++WD
Sbjct: 148 GSRRGQQLLCSGSDDRTIKIWD 169



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 18/64 (28%), Positives = 35/64 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + ++S   D  + +W + +    +      L GHS  I+ + LS +G++ L+ + D TLR
Sbjct: 195 EQVISGGIDNEVKIWDIRKQAVLH-----HLRGHSDTITGMSLSPEGDFILTNAMDNTLR 249

Query: 305 LWDL 316
           +WD+
Sbjct: 250 VWDV 253



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 21/84 (25%), Positives = 37/84 (44%)
 Frame = +2

Query: 65  GTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISD 244
           GT R +N  +          D++  ++RDK L+   + R  +N   P  +L GH   I  
Sbjct: 2   GTKRPNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRT-SNLQAPIMQLEGHEGEIFT 60

Query: 245 VVLSSDGNYALSGSWDKTLRLWDL 316
                +G   LS  +D+ + +W +
Sbjct: 61  AEFHPEGELLLSSGFDRQIYIWQV 84



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/42 (42%), Positives = 26/42 (61%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           T ++   L GHNG V  +  +PK P +ILS S DKTL + ++
Sbjct: 305 TRRILYKLPGHNGSVNAVDFSPKEP-LILSGSSDKTLYLGEI 345



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 18/95 (18%), Positives = 39/95 (41%), Gaps = 1/95 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF-ISDVV 250
           +GH  +V  +  + +   ++ S S D+T+ +W   +    + +        S F ++ V 
Sbjct: 137 KGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTL-------ESPFQVTAVC 189

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
               G   +SG  D  +++WD+           H+
Sbjct: 190 FGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHS 224



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 21/64 (32%), Positives = 31/64 (48%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I S S D+ + +W +      Y +P     GH+  ++ V  S      LSGS DKTL 
Sbjct: 287 DKITSGSADRHVYIWDVNTRRILYKLP-----GHNGSVNAVDFSPKEPLILSGSSDKTLY 341

Query: 305 LWDL 316
           L ++
Sbjct: 342 LGEI 345


>AY051707-1|AAK93131.1|  482|Drosophila melanogaster LD24662p
           protein.
          Length = 482

 Score = 58.4 bits (135), Expect = 7e-09
 Identities = 32/94 (34%), Positives = 50/94 (53%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +A +P   D++ +S RD T  +W +    N +      L GH++ ++ VV  
Sbjct: 254 GHLSAVYSLALHPTI-DVLATSGRDSTARIWDMRTKANVH-----TLTGHTNTVASVVAQ 307

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           +     ++GS D T+RLWDLAAGK+     +H K
Sbjct: 308 ATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHKK 341



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 30/108 (27%), Positives = 45/108 (41%)
 Frame = +2

Query: 29  PFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           P  K     KL   + GH GWV  IA  P   +   + + D+ + +W L       G  +
Sbjct: 154 PKPKWHAPWKLSRVISGHLGWVRCIAVEPGN-EWFATGAGDRVIKIWDLAS-----GKLK 207

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             L GH   +  V +S+   Y  S   D+ ++ WDL   K  R +  H
Sbjct: 208 LSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGH 255



 Score = 37.1 bits (82), Expect = 0.019
 Identities = 24/100 (24%), Positives = 40/100 (40%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL+ +L GH   V  +A + K+P  + S   D+ +  W L      Y    +  +GH   
Sbjct: 205 KLKLSLTGHVSTVRGVAVSTKHP-YLFSCGEDRQVKCWDL-----EYNKVIRHYHGHLSA 258

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  + L    +   +   D T R+WD+           HT
Sbjct: 259 VYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHT 298


>AE014298-1742|AAF48133.1|  482|Drosophila melanogaster CG1796-PA
           protein.
          Length = 482

 Score = 58.4 bits (135), Expect = 7e-09
 Identities = 32/94 (34%), Positives = 50/94 (53%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +A +P   D++ +S RD T  +W +    N +      L GH++ ++ VV  
Sbjct: 254 GHLSAVYSLALHPTI-DVLATSGRDSTARIWDMRTKANVH-----TLTGHTNTVASVVAQ 307

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           +     ++GS D T+RLWDLAAGK+     +H K
Sbjct: 308 ATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHKK 341



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 30/108 (27%), Positives = 45/108 (41%)
 Frame = +2

Query: 29  PFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           P  K     KL   + GH GWV  IA  P   +   + + D+ + +W L       G  +
Sbjct: 154 PKPKWHAPWKLSRVISGHLGWVRCIAVEPGN-EWFATGAGDRVIKIWDLAS-----GKLK 207

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             L GH   +  V +S+   Y  S   D+ ++ WDL   K  R +  H
Sbjct: 208 LSLTGHVSTVRGVAVSTKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGH 255



 Score = 37.1 bits (82), Expect = 0.019
 Identities = 24/100 (24%), Positives = 40/100 (40%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           KL+ +L GH   V  +A + K+P  + S   D+ +  W L      Y    +  +GH   
Sbjct: 205 KLKLSLTGHVSTVRGVAVSTKHP-YLFSCGEDRQVKCWDL-----EYNKVIRHYHGHLSA 258

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  + L    +   +   D T R+WD+           HT
Sbjct: 259 VYSLALHPTIDVLATSGRDSTARIWDMRTKANVHTLTGHT 298


>BT021404-1|AAX33552.1|  411|Drosophila melanogaster LD11219p
           protein.
          Length = 411

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+ WV  +A +P  KY   ++S+S DKT+ VW L           K LY H HF +
Sbjct: 334 TLSGHDNWVRGLAFHPGGKY---LVSASDDKTIRVWDLRNKRC-----MKTLYAHQHFCT 385

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y +SGS D+T+++W+
Sbjct: 386 SIDFHKAHPYVISGSVDQTVKVWE 409



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/102 (28%), Positives = 54/102 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   +L+GH   V  +A + +   ++ S S D ++ +W     + +Y    K ++GH
Sbjct: 138 ETGEYERSLKGHTDSVQDVAFDAQ-GKLLASCSADLSIKLWDF---QQSYECI-KTMHGH 192

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G+Y LS S D+T+++W++A G   + +  H
Sbjct: 193 DHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGH 234



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S SRDKT+ +W ++      G+    L GH +++  +     G Y +S S DKT+R+W
Sbjct: 312 LASGSRDKTIRIWDVS-----VGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 366

Query: 311 DL 316
           DL
Sbjct: 367 DL 368



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D +LS+SRD+T+ +W++       G   K   GH  ++  V
Sbjct: 188 TMHGHDHNVSSVAFVPA-GDYVLSASRDRTIKMWEVAT-----GYCVKTYTGHREWVRMV 241

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +  +G+   + S D+T+R+W
Sbjct: 242 RVHIEGSIFATCSNDQTIRVW 262



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   I+ V+        +S S D T+R+WD   G+  R  + HT
Sbjct: 99  PEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHT 150



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAG 325
           G +  SGS DKT+R+WD++ G
Sbjct: 309 GPFLASGSRDKTIRIWDVSVG 329


>BT015296-1|AAT94525.1| 1923|Drosophila melanogaster AT26369p protein.
          Length = 1923

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 35/99 (35%), Positives = 50/99 (50%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL   L GH+  VT +A +      +LS S+D  LI+W L   E  +      L GH   
Sbjct: 1409 KLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLILWDLLTGEEVH-----TLAGHLGP 1463

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  V +S+DG+ A+SGS DKTL +W+   G      + H
Sbjct: 1464 VIGVKVSADGSTAVSGSDDKTLIVWETKRGLALTSLQMH 1502



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/74 (29%), Positives = 41/74 (55%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            +S++ D TL +W LT+++  Y +       HS  I+   +S+D  + +SGS D +L++W 
Sbjct: 1351 VSTNGDNTLKIWSLTQEDEKYSV------SHSDEITCFEISADSVHIISGSRDMSLKVWQ 1404

Query: 314  LAAGKTTRRFEDHT 355
               GK ++    H+
Sbjct: 1405 ATGGKLSQVLVGHS 1418



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYP-DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            +GH   VT +   P+   +++L+ S D T++VW +   E    I       H+  I+ V 
Sbjct: 936  KGHTAAVTCLLVAPQSDSELLLTGSEDATVLVWHVGLRERRAHIKN----AHTAPITGVA 991

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++    +S S D ++ + DLA+GK   R   H
Sbjct: 992  AGANNTLIISSSEDASIAITDLASGKLRHRITHH 1025



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 28/75 (37%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
            I+S SRD +L VW+ T      G   + L GHS  ++ V +S ++    LSGS D  L L
Sbjct: 1391 IISGSRDMSLKVWQATG-----GKLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLIL 1445

Query: 308  WDLAAGKTTRRFEDH 352
            WDL  G+       H
Sbjct: 1446 WDLLTGEEVHTLAGH 1460



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = +2

Query: 206  QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            Q  L GH+  +S +  + +G +  +GS D+ + +W+LA G+    F+ HT
Sbjct: 1247 QCTLEGHTAGVSCLKFAPNGEFLATGSEDRLVHIWNLALGEICNSFKGHT 1296



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 21/79 (26%), Positives = 39/79 (49%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H   +T +A       +I+SSS D ++ +  L       G  + R+  H   +S +V++ 
Sbjct: 983  HTAPITGVAAGANNT-LIISSSEDASIAITDLAS-----GKLRHRITHHRGPVSGIVVAG 1036

Query: 260  DGNYALSGSWDKTLRLWDL 316
              +  +SG  D+T+ +WDL
Sbjct: 1037 ACDVLISGGLDRTICVWDL 1055


>AY089600-1|AAL90338.1|  256|Drosophila melanogaster RE19540p
           protein.
          Length = 256

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+ WV  +A +P  KY   ++S+S DKT+ VW L           K LY H HF +
Sbjct: 179 TLSGHDNWVRGLAFHPGGKY---LVSASDDKTIRVWDLRNKRC-----MKTLYAHQHFCT 230

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y +SGS D+T+++W+
Sbjct: 231 SIDFHKAHPYVISGSVDQTVKVWE 254



 Score = 46.8 bits (106), Expect = 2e-05
 Identities = 17/48 (35%), Positives = 29/48 (60%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           K ++GH H +S V     G+Y LS S D+T+++W++A G   + +  H
Sbjct: 32  KTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGH 79



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S SRDKT+ +W ++      G+    L GH +++  +     G Y +S S DKT+R+W
Sbjct: 157 LASGSRDKTIRIWDVS-----VGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 211

Query: 311 DL 316
           DL
Sbjct: 212 DL 213



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D +LS+SRD+T+ +W++       G   K   GH  ++  V
Sbjct: 33  TMHGHDHNVSSVAFVPA-GDYVLSASRDRTIKMWEVAT-----GYCVKTYTGHREWVRMV 86

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +  +G+   + S D+T+R+W
Sbjct: 87  RVHIEGSIFATCSNDQTIRVW 107



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAG 325
           G +  SGS DKT+R+WD++ G
Sbjct: 154 GPFLASGSRDKTIRIWDVSVG 174


>AF181630-1|AAD55416.1| 1228|Drosophila melanogaster BcDNA.GH04922
            protein.
          Length = 1228

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 35/99 (35%), Positives = 50/99 (50%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL   L GH+  VT +A +      +LS S+D  LI+W L   E  +      L GH   
Sbjct: 939  KLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLILWDLLTGEEVH-----TLAGHLGP 993

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  V +S+DG+ A+SGS DKTL +W+   G      + H
Sbjct: 994  VIGVKVSADGSTAVSGSDDKTLIVWETKRGLALTSLQMH 1032



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/74 (29%), Positives = 41/74 (55%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            +S++ D TL +W LT+++  Y +       HS  I+   +S+D  + +SGS D +L++W 
Sbjct: 881  VSTNGDNTLKIWSLTQEDEKYSV------SHSDEITCFEISADSVHIISGSRDMSLKVWQ 934

Query: 314  LAAGKTTRRFEDHT 355
               GK ++    H+
Sbjct: 935  ATGGKLSQVLVGHS 948



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYP-DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           +GH   VT +   P+   +++L+ S D T++VW +   E    I       H+  I+ V 
Sbjct: 466 KGHTAAVTCLLVAPQSDSELLLTGSEDATVLVWHVGLRERRAHIKN----AHTAPITGVA 521

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             ++    +S S D ++ + DLA+GK   R   H
Sbjct: 522 AGANNTLIISSSEDASIAITDLASGKLRHRITHH 555



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 28/75 (37%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
            I+S SRD +L VW+ T      G   + L GHS  ++ V +S ++    LSGS D  L L
Sbjct: 921  IISGSRDMSLKVWQATG-----GKLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLIL 975

Query: 308  WDLAAGKTTRRFEDH 352
            WDL  G+       H
Sbjct: 976  WDLLTGEEVHTLAGH 990



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           Q  L GH+  +S +  + +G +  +GS D+ + +W+LA G+    F+ HT
Sbjct: 777 QCTLEGHTAGVSCLKFAPNGEFLATGSEDRLVHIWNLALGEICNSFKGHT 826



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 21/79 (26%), Positives = 39/79 (49%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H   +T +A       +I+SSS D ++ +  L       G  + R+  H   +S +V++ 
Sbjct: 513 HTAPITGVAAGANNT-LIISSSEDASIAITDLAS-----GKLRHRITHHRGPVSGIVVAG 566

Query: 260 DGNYALSGSWDKTLRLWDL 316
             +  +SG  D+T+ +WDL
Sbjct: 567 ACDVLISGGLDRTICVWDL 585


>AF152419-1|AAD38390.1|  411|Drosophila melanogaster WD-40 protein
           LIS1 protein.
          Length = 411

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+ WV  +A +P  KY   ++S+S DKT+ VW L           K LY H HF +
Sbjct: 334 TLSGHDNWVRGLAFHPGGKY---LVSASDDKTIRVWDLRNKRC-----MKTLYAHQHFCT 385

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y +SGS D+T+++W+
Sbjct: 386 SIDFHKAHPYVISGSVDQTVKVWE 409



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/102 (28%), Positives = 54/102 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   +L+GH   V  +A + +   ++ S S D ++ +W     + +Y    K ++GH
Sbjct: 138 ETGEYERSLKGHTDSVQDVAFDAQ-GKLLASCSADLSIKLWDF---QQSYECI-KTMHGH 192

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G+Y LS S D+T+++W++A G   + +  H
Sbjct: 193 DHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGH 234



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S SRDKT+ +W ++      G+    L GH +++  +     G Y +S S DKT+R+W
Sbjct: 312 LASGSRDKTIRIWDVS-----VGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 366

Query: 311 DL 316
           DL
Sbjct: 367 DL 368



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D +LS+SRD+T+ +W++       G   K   GH  ++  V
Sbjct: 188 TMHGHDHNVSSVAFVPA-GDYVLSASRDRTIKMWEVAT-----GYCVKTYTGHREWVRMV 241

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +  +G+   + S D+T+R+W
Sbjct: 242 RVHIEGSIFATCSNDQTIRVW 262



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   I+ V+        +S S D T+R+WD   G+  R  + HT
Sbjct: 99  PEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHT 150



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAG 325
           G +  SGS DKT+R+WD++ G
Sbjct: 309 GPFLASGSRDKTIRIWDVSVG 329


>AF117606-1|AAD13113.1|  411|Drosophila melanogaster lissencephaly-1
           protein.
          Length = 411

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+ WV  +A +P  KY   ++S+S DKT+ VW L           K LY H HF +
Sbjct: 334 TLSGHDNWVRGLAFHPGGKY---LVSASDDKTIRVWDLRNKRC-----MKTLYAHQHFCT 385

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y +SGS D+T+++W+
Sbjct: 386 SIDFHKAHPYVISGSVDQTVKVWE 409



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/102 (28%), Positives = 54/102 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   +L+GH   V  +A + +   ++ S S D ++ +W     + +Y    K ++GH
Sbjct: 138 ETGEYERSLKGHTDSVQDVAFDAQ-GKLLASCSADLSIKLWDF---QQSYECI-KTMHGH 192

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G+Y LS S D+T+++W++A G   + +  H
Sbjct: 193 DHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGH 234



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S SRDKT+ +W ++      G+    L GH +++  +     G Y +S S DKT+R+W
Sbjct: 312 LASGSRDKTIRIWDVS-----VGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 366

Query: 311 DL 316
           DL
Sbjct: 367 DL 368



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D +LS+SRD+T+ +W++       G   K   GH  ++  V
Sbjct: 188 TMHGHDHNVSSVAFVPA-GDYVLSASRDRTIKMWEVAT-----GYCVKTYTGHREWVRMV 241

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +  +G+   + S D+T+R+W
Sbjct: 242 RVHIEGSIFATCSNDQTIRVW 262



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   I+ V+        +S S D T+R+WD   G+  R  + HT
Sbjct: 99  PEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHT 150



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAG 325
           G +  SGS DKT+R+WD++ G
Sbjct: 309 GPFLASGSRDKTIRIWDVSVG 329


>AF098070-1|AAC83821.1|  409|Drosophila melanogaster Lis1 homolog
           protein.
          Length = 409

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+ WV  +A +P  KY   ++S+S DKT+ VW L           K LY H HF +
Sbjct: 332 TLSGHDNWVRGLAFHPGGKY---LVSASDDKTIRVWDLRNKRC-----MKTLYAHQHFCT 383

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y +SGS D+T+++W+
Sbjct: 384 SIDFHKAHPYVISGSVDQTVKVWE 407



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/102 (28%), Positives = 54/102 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   +L+GH   V  +A + +   ++ S S D ++ +W     + +Y    K ++GH
Sbjct: 136 ETGEYERSLKGHTDSVQDVAFDAQ-GKLLASCSADLSIKLWDF---QQSYECI-KTMHGH 190

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G+Y LS S D+T+++W++A G   + +  H
Sbjct: 191 DHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGH 232



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S SRDKT+ +W ++      G+    L GH +++  +     G Y +S S DKT+R+W
Sbjct: 310 LASGSRDKTIRIWDVS-----VGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 364

Query: 311 DL 316
           DL
Sbjct: 365 DL 366



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D +LS+SRD+T+ +W++       G   K   GH  ++  V
Sbjct: 186 TMHGHDHNVSSVAFVPA-GDYVLSASRDRTIKMWEVAT-----GYCVKTYTGHREWVRMV 239

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +  +G+   + S D+T+R+W
Sbjct: 240 RVHIEGSIFATCSNDQTIRVW 260



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   I+ V+        +S S D T+R+WD   G+  R  + HT
Sbjct: 97  PEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHT 148



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAG 325
           G +  SGS DKT+R+WD++ G
Sbjct: 307 GPFLASGSRDKTIRIWDVSVG 327


>AE013599-2711|AAM68461.1| 1922|Drosophila melanogaster CG30116-PA,
            isoform A protein.
          Length = 1922

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 35/99 (35%), Positives = 50/99 (50%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL   L GH+  VT +A +      +LS S+D  LI+W L   E  +      L GH   
Sbjct: 1409 KLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLILWDLLTGEEVH-----TLAGHLGP 1463

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  V +S+DG+ A+SGS DKTL +W+   G      + H
Sbjct: 1464 VIGVKVSADGSTAVSGSDDKTLIVWETKRGLALTSLQMH 1502



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/74 (29%), Positives = 41/74 (55%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            +S++ D TL +W LT+++  Y +       HS  I+   +S+D  + +SGS D +L++W 
Sbjct: 1351 VSTNGDNTLKIWSLTQEDEKYSV------SHSDEITCFEISADSVHIISGSRDMSLKVWQ 1404

Query: 314  LAAGKTTRRFEDHT 355
               GK ++    H+
Sbjct: 1405 ATGGKLSQVLVGHS 1418



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYP-DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            +GH   VT +   P+   +++L+ S D T++VW +   E    I       H+  I+ V 
Sbjct: 936  KGHTAAVTCLLVAPQSDSELLLTGSEDATVLVWHVGLRERRAHIKN----AHTAPITGVA 991

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++    +S S D ++ + DLA+GK   R   H
Sbjct: 992  AGANNTLIISSSEDASIAITDLASGKLRHRITHH 1025



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 28/75 (37%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
            I+S SRD +L VW+ T      G   + L GHS  ++ V +S ++    LSGS D  L L
Sbjct: 1391 IISGSRDMSLKVWQATG-----GKLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLIL 1445

Query: 308  WDLAAGKTTRRFEDH 352
            WDL  G+       H
Sbjct: 1446 WDLLTGEEVHTLAGH 1460



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = +2

Query: 206  QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            Q  L GH+  +S +  + +G +  +GS D+ + +W+LA G+    F+ HT
Sbjct: 1247 QCTLEGHTAGVSCLKFAPNGEFLATGSEDRLVHIWNLALGEICNSFKGHT 1296



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 21/79 (26%), Positives = 39/79 (49%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H   +T +A       +I+SSS D ++ +  L       G  + R+  H   +S +V++ 
Sbjct: 983  HTAPITGVAAGANNT-LIISSSEDASIAITDLAS-----GKLRHRITHHRGPVSGIVVAG 1036

Query: 260  DGNYALSGSWDKTLRLWDL 316
              +  +SG  D+T+ +WDL
Sbjct: 1037 ACDVLISGGLDRTICVWDL 1055


>AE013599-2710|AAF57680.2| 1701|Drosophila melanogaster CG30116-PD,
            isoform D protein.
          Length = 1701

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 35/99 (35%), Positives = 50/99 (50%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL   L GH+  VT +A +      +LS S+D  LI+W L   E  +      L GH   
Sbjct: 1409 KLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLILWDLLTGEEVH-----TLAGHLGP 1463

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  V +S+DG+ A+SGS DKTL +W+   G      + H
Sbjct: 1464 VIGVKVSADGSTAVSGSDDKTLIVWETKRGLALTSLQMH 1502



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/74 (29%), Positives = 41/74 (55%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            +S++ D TL +W LT+++  Y +       HS  I+   +S+D  + +SGS D +L++W 
Sbjct: 1351 VSTNGDNTLKIWSLTQEDEKYSV------SHSDEITCFEISADSVHIISGSRDMSLKVWQ 1404

Query: 314  LAAGKTTRRFEDHT 355
               GK ++    H+
Sbjct: 1405 ATGGKLSQVLVGHS 1418



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYP-DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            +GH   VT +   P+   +++L+ S D T++VW +   E    I       H+  I+ V 
Sbjct: 936  KGHTAAVTCLLVAPQSDSELLLTGSEDATVLVWHVGLRERRAHIKN----AHTAPITGVA 991

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++    +S S D ++ + DLA+GK   R   H
Sbjct: 992  AGANNTLIISSSEDASIAITDLASGKLRHRITHH 1025



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 28/75 (37%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
            I+S SRD +L VW+ T      G   + L GHS  ++ V +S ++    LSGS D  L L
Sbjct: 1391 IISGSRDMSLKVWQATG-----GKLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLIL 1445

Query: 308  WDLAAGKTTRRFEDH 352
            WDL  G+       H
Sbjct: 1446 WDLLTGEEVHTLAGH 1460



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = +2

Query: 206  QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            Q  L GH+  +S +  + +G +  +GS D+ + +W+LA G+    F+ HT
Sbjct: 1247 QCTLEGHTAGVSCLKFAPNGEFLATGSEDRLVHIWNLALGEICNSFKGHT 1296



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 21/79 (26%), Positives = 39/79 (49%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H   +T +A       +I+SSS D ++ +  L       G  + R+  H   +S +V++ 
Sbjct: 983  HTAPITGVAAGANNT-LIISSSEDASIAITDLAS-----GKLRHRITHHRGPVSGIVVAG 1036

Query: 260  DGNYALSGSWDKTLRLWDL 316
              +  +SG  D+T+ +WDL
Sbjct: 1037 ACDVLISGGLDRTICVWDL 1055


>AE013599-2709|AAF57681.2| 1698|Drosophila melanogaster CG30116-PC,
            isoform C protein.
          Length = 1698

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 35/99 (35%), Positives = 50/99 (50%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL   L GH+  VT +A +      +LS S+D  LI+W L   E  +      L GH   
Sbjct: 1409 KLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLILWDLLTGEEVH-----TLAGHLGP 1463

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  V +S+DG+ A+SGS DKTL +W+   G      + H
Sbjct: 1464 VIGVKVSADGSTAVSGSDDKTLIVWETKRGLALTSLQMH 1502



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/74 (29%), Positives = 41/74 (55%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            +S++ D TL +W LT+++  Y +       HS  I+   +S+D  + +SGS D +L++W 
Sbjct: 1351 VSTNGDNTLKIWSLTQEDEKYSV------SHSDEITCFEISADSVHIISGSRDMSLKVWQ 1404

Query: 314  LAAGKTTRRFEDHT 355
               GK ++    H+
Sbjct: 1405 ATGGKLSQVLVGHS 1418



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYP-DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            +GH   VT +   P+   +++L+ S D T++VW +   E    I       H+  I+ V 
Sbjct: 936  KGHTAAVTCLLVAPQSDSELLLTGSEDATVLVWHVGLRERRAHIKN----AHTAPITGVA 991

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++    +S S D ++ + DLA+GK   R   H
Sbjct: 992  AGANNTLIISSSEDASIAITDLASGKLRHRITHH 1025



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 28/75 (37%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
            I+S SRD +L VW+ T      G   + L GHS  ++ V +S ++    LSGS D  L L
Sbjct: 1391 IISGSRDMSLKVWQATG-----GKLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLIL 1445

Query: 308  WDLAAGKTTRRFEDH 352
            WDL  G+       H
Sbjct: 1446 WDLLTGEEVHTLAGH 1460



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = +2

Query: 206  QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            Q  L GH+  +S +  + +G +  +GS D+ + +W+LA G+    F+ HT
Sbjct: 1247 QCTLEGHTAGVSCLKFAPNGEFLATGSEDRLVHIWNLALGEICNSFKGHT 1296



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 21/79 (26%), Positives = 39/79 (49%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H   +T +A       +I+SSS D ++ +  L       G  + R+  H   +S +V++ 
Sbjct: 983  HTAPITGVAAGANNT-LIISSSEDASIAITDLAS-----GKLRHRITHHRGPVSGIVVAG 1036

Query: 260  DGNYALSGSWDKTLRLWDL 316
              +  +SG  D+T+ +WDL
Sbjct: 1037 ACDVLISGGLDRTICVWDL 1055


>AE013599-2708|AAM68460.1| 1698|Drosophila melanogaster CG30116-PB,
            isoform B protein.
          Length = 1698

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 35/99 (35%), Positives = 50/99 (50%)
 Frame = +2

Query: 56   KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
            KL   L GH+  VT +A +      +LS S+D  LI+W L   E  +      L GH   
Sbjct: 1409 KLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLILWDLLTGEEVH-----TLAGHLGP 1463

Query: 236  ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            +  V +S+DG+ A+SGS DKTL +W+   G      + H
Sbjct: 1464 VIGVKVSADGSTAVSGSDDKTLIVWETKRGLALTSLQMH 1502



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/74 (29%), Positives = 41/74 (55%)
 Frame = +2

Query: 134  LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
            +S++ D TL +W LT+++  Y +       HS  I+   +S+D  + +SGS D +L++W 
Sbjct: 1351 VSTNGDNTLKIWSLTQEDEKYSV------SHSDEITCFEISADSVHIISGSRDMSLKVWQ 1404

Query: 314  LAAGKTTRRFEDHT 355
               GK ++    H+
Sbjct: 1405 ATGGKLSQVLVGHS 1418



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 26/94 (27%), Positives = 45/94 (47%), Gaps = 1/94 (1%)
 Frame = +2

Query: 74   RGHNGWVTQIATNPKYP-DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            +GH   VT +   P+   +++L+ S D T++VW +   E    I       H+  I+ V 
Sbjct: 936  KGHTAAVTCLLVAPQSDSELLLTGSEDATVLVWHVGLRERRAHIKN----AHTAPITGVA 991

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              ++    +S S D ++ + DLA+GK   R   H
Sbjct: 992  AGANNTLIISSSEDASIAITDLASGKLRHRITHH 1025



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 28/75 (37%), Positives = 38/75 (50%), Gaps = 1/75 (1%)
 Frame = +2

Query: 131  ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
            I+S SRD +L VW+ T      G   + L GHS  ++ V +S ++    LSGS D  L L
Sbjct: 1391 IISGSRDMSLKVWQATG-----GKLSQVLVGHSDAVTCVAVSVTNKTQVLSGSKDMNLIL 1445

Query: 308  WDLAAGKTTRRFEDH 352
            WDL  G+       H
Sbjct: 1446 WDLLTGEEVHTLAGH 1460



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 16/50 (32%), Positives = 29/50 (58%)
 Frame = +2

Query: 206  QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            Q  L GH+  +S +  + +G +  +GS D+ + +W+LA G+    F+ HT
Sbjct: 1247 QCTLEGHTAGVSCLKFAPNGEFLATGSEDRLVHIWNLALGEICNSFKGHT 1296



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 21/79 (26%), Positives = 39/79 (49%)
 Frame = +2

Query: 80   HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
            H   +T +A       +I+SSS D ++ +  L       G  + R+  H   +S +V++ 
Sbjct: 983  HTAPITGVAAGANNT-LIISSSEDASIAITDLAS-----GKLRHRITHHRGPVSGIVVAG 1036

Query: 260  DGNYALSGSWDKTLRLWDL 316
              +  +SG  D+T+ +WDL
Sbjct: 1037 ACDVLISGGLDRTICVWDL 1055


>AE013599-2210|AAS64845.1|  411|Drosophila melanogaster CG8440-PF,
           isoform F protein.
          Length = 411

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+ WV  +A +P  KY   ++S+S DKT+ VW L           K LY H HF +
Sbjct: 334 TLSGHDNWVRGLAFHPGGKY---LVSASDDKTIRVWDLRNKRC-----MKTLYAHQHFCT 385

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y +SGS D+T+++W+
Sbjct: 386 SIDFHKAHPYVISGSVDQTVKVWE 409



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/102 (28%), Positives = 54/102 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   +L+GH   V  +A + +   ++ S S D ++ +W     + +Y    K ++GH
Sbjct: 138 ETGEYERSLKGHTDSVQDVAFDAQ-GKLLASCSADLSIKLWDF---QQSYECI-KTMHGH 192

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G+Y LS S D+T+++W++A G   + +  H
Sbjct: 193 DHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGH 234



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S SRDKT+ +W ++      G+    L GH +++  +     G Y +S S DKT+R+W
Sbjct: 312 LASGSRDKTIRIWDVS-----VGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 366

Query: 311 DL 316
           DL
Sbjct: 367 DL 368



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D +LS+SRD+T+ +W++       G   K   GH  ++  V
Sbjct: 188 TMHGHDHNVSSVAFVPA-GDYVLSASRDRTIKMWEVAT-----GYCVKTYTGHREWVRMV 241

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +  +G+   + S D+T+R+W
Sbjct: 242 RVHIEGSIFATCSNDQTIRVW 262



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   I+ V+        +S S D T+R+WD   G+  R  + HT
Sbjct: 99  PEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHT 150



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAG 325
           G +  SGS DKT+R+WD++ G
Sbjct: 309 GPFLASGSRDKTIRIWDVSVG 329


>AE013599-2209|AAO41383.1|  411|Drosophila melanogaster CG8440-PE,
           isoform E protein.
          Length = 411

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+ WV  +A +P  KY   ++S+S DKT+ VW L           K LY H HF +
Sbjct: 334 TLSGHDNWVRGLAFHPGGKY---LVSASDDKTIRVWDLRNKRC-----MKTLYAHQHFCT 385

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y +SGS D+T+++W+
Sbjct: 386 SIDFHKAHPYVISGSVDQTVKVWE 409



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/102 (28%), Positives = 54/102 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   +L+GH   V  +A + +   ++ S S D ++ +W     + +Y    K ++GH
Sbjct: 138 ETGEYERSLKGHTDSVQDVAFDAQ-GKLLASCSADLSIKLWDF---QQSYECI-KTMHGH 192

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G+Y LS S D+T+++W++A G   + +  H
Sbjct: 193 DHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGH 234



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S SRDKT+ +W ++      G+    L GH +++  +     G Y +S S DKT+R+W
Sbjct: 312 LASGSRDKTIRIWDVS-----VGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 366

Query: 311 DL 316
           DL
Sbjct: 367 DL 368



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D +LS+SRD+T+ +W++       G   K   GH  ++  V
Sbjct: 188 TMHGHDHNVSSVAFVPA-GDYVLSASRDRTIKMWEVAT-----GYCVKTYTGHREWVRMV 241

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +  +G+   + S D+T+R+W
Sbjct: 242 RVHIEGSIFATCSNDQTIRVW 262



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   I+ V+        +S S D T+R+WD   G+  R  + HT
Sbjct: 99  PEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHT 150



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAG 325
           G +  SGS DKT+R+WD++ G
Sbjct: 309 GPFLASGSRDKTIRIWDVSVG 329


>AE013599-2208|AAO41382.1|  411|Drosophila melanogaster CG8440-PD,
           isoform D protein.
          Length = 411

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+ WV  +A +P  KY   ++S+S DKT+ VW L           K LY H HF +
Sbjct: 334 TLSGHDNWVRGLAFHPGGKY---LVSASDDKTIRVWDLRNKRC-----MKTLYAHQHFCT 385

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y +SGS D+T+++W+
Sbjct: 386 SIDFHKAHPYVISGSVDQTVKVWE 409



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/102 (28%), Positives = 54/102 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   +L+GH   V  +A + +   ++ S S D ++ +W     + +Y    K ++GH
Sbjct: 138 ETGEYERSLKGHTDSVQDVAFDAQ-GKLLASCSADLSIKLWDF---QQSYECI-KTMHGH 192

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G+Y LS S D+T+++W++A G   + +  H
Sbjct: 193 DHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGH 234



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S SRDKT+ +W ++      G+    L GH +++  +     G Y +S S DKT+R+W
Sbjct: 312 LASGSRDKTIRIWDVS-----VGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 366

Query: 311 DL 316
           DL
Sbjct: 367 DL 368



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D +LS+SRD+T+ +W++       G   K   GH  ++  V
Sbjct: 188 TMHGHDHNVSSVAFVPA-GDYVLSASRDRTIKMWEVAT-----GYCVKTYTGHREWVRMV 241

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +  +G+   + S D+T+R+W
Sbjct: 242 RVHIEGSIFATCSNDQTIRVW 262



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   I+ V+        +S S D T+R+WD   G+  R  + HT
Sbjct: 99  PEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHT 150



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAG 325
           G +  SGS DKT+R+WD++ G
Sbjct: 309 GPFLASGSRDKTIRIWDVSVG 329


>AE013599-2207|AAO41381.1|  411|Drosophila melanogaster CG8440-PC,
           isoform C protein.
          Length = 411

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+ WV  +A +P  KY   ++S+S DKT+ VW L           K LY H HF +
Sbjct: 334 TLSGHDNWVRGLAFHPGGKY---LVSASDDKTIRVWDLRNKRC-----MKTLYAHQHFCT 385

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y +SGS D+T+++W+
Sbjct: 386 SIDFHKAHPYVISGSVDQTVKVWE 409



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/102 (28%), Positives = 54/102 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   +L+GH   V  +A + +   ++ S S D ++ +W     + +Y    K ++GH
Sbjct: 138 ETGEYERSLKGHTDSVQDVAFDAQ-GKLLASCSADLSIKLWDF---QQSYECI-KTMHGH 192

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G+Y LS S D+T+++W++A G   + +  H
Sbjct: 193 DHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGH 234



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S SRDKT+ +W ++      G+    L GH +++  +     G Y +S S DKT+R+W
Sbjct: 312 LASGSRDKTIRIWDVS-----VGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 366

Query: 311 DL 316
           DL
Sbjct: 367 DL 368



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D +LS+SRD+T+ +W++       G   K   GH  ++  V
Sbjct: 188 TMHGHDHNVSSVAFVPA-GDYVLSASRDRTIKMWEVAT-----GYCVKTYTGHREWVRMV 241

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +  +G+   + S D+T+R+W
Sbjct: 242 RVHIEGSIFATCSNDQTIRVW 262



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   I+ V+        +S S D T+R+WD   G+  R  + HT
Sbjct: 99  PEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHT 150



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAG 325
           G +  SGS DKT+R+WD++ G
Sbjct: 309 GPFLASGSRDKTIRIWDVSVG 329


>AE013599-2206|AAO41380.1|  411|Drosophila melanogaster CG8440-PB,
           isoform B protein.
          Length = 411

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+ WV  +A +P  KY   ++S+S DKT+ VW L           K LY H HF +
Sbjct: 334 TLSGHDNWVRGLAFHPGGKY---LVSASDDKTIRVWDLRNKRC-----MKTLYAHQHFCT 385

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y +SGS D+T+++W+
Sbjct: 386 SIDFHKAHPYVISGSVDQTVKVWE 409



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/102 (28%), Positives = 54/102 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   +L+GH   V  +A + +   ++ S S D ++ +W     + +Y    K ++GH
Sbjct: 138 ETGEYERSLKGHTDSVQDVAFDAQ-GKLLASCSADLSIKLWDF---QQSYECI-KTMHGH 192

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G+Y LS S D+T+++W++A G   + +  H
Sbjct: 193 DHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGH 234



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S SRDKT+ +W ++      G+    L GH +++  +     G Y +S S DKT+R+W
Sbjct: 312 LASGSRDKTIRIWDVS-----VGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 366

Query: 311 DL 316
           DL
Sbjct: 367 DL 368



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D +LS+SRD+T+ +W++       G   K   GH  ++  V
Sbjct: 188 TMHGHDHNVSSVAFVPA-GDYVLSASRDRTIKMWEVAT-----GYCVKTYTGHREWVRMV 241

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +  +G+   + S D+T+R+W
Sbjct: 242 RVHIEGSIFATCSNDQTIRVW 262



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   I+ V+        +S S D T+R+WD   G+  R  + HT
Sbjct: 99  PEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHT 150



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAG 325
           G +  SGS DKT+R+WD++ G
Sbjct: 309 GPFLASGSRDKTIRIWDVSVG 329


>AE013599-2205|AAF58050.1|  411|Drosophila melanogaster CG8440-PA,
           isoform A protein.
          Length = 411

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 31/84 (36%), Positives = 46/84 (54%), Gaps = 2/84 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNP--KYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
           TL GH+ WV  +A +P  KY   ++S+S DKT+ VW L           K LY H HF +
Sbjct: 334 TLSGHDNWVRGLAFHPGGKY---LVSASDDKTIRVWDLRNKRC-----MKTLYAHQHFCT 385

Query: 242 DVVLSSDGNYALSGSWDKTLRLWD 313
            +       Y +SGS D+T+++W+
Sbjct: 386 SIDFHKAHPYVISGSVDQTVKVWE 409



 Score = 54.0 bits (124), Expect = 2e-07
 Identities = 29/102 (28%), Positives = 54/102 (52%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           ET +   +L+GH   V  +A + +   ++ S S D ++ +W     + +Y    K ++GH
Sbjct: 138 ETGEYERSLKGHTDSVQDVAFDAQ-GKLLASCSADLSIKLWDF---QQSYECI-KTMHGH 192

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            H +S V     G+Y LS S D+T+++W++A G   + +  H
Sbjct: 193 DHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGH 234



 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S SRDKT+ +W ++      G+    L GH +++  +     G Y +S S DKT+R+W
Sbjct: 312 LASGSRDKTIRIWDVS-----VGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVW 366

Query: 311 DL 316
           DL
Sbjct: 367 DL 368



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 25/81 (30%), Positives = 45/81 (55%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+ GH+  V+ +A  P   D +LS+SRD+T+ +W++       G   K   GH  ++  V
Sbjct: 188 TMHGHDHNVSSVAFVPA-GDYVLSASRDRTIKMWEVAT-----GYCVKTYTGHREWVRMV 241

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            +  +G+   + S D+T+R+W
Sbjct: 242 RVHIEGSIFATCSNDQTIRVW 262



 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +2

Query: 203 PQK-RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           P+K  L GH   I+ V+        +S S D T+R+WD   G+  R  + HT
Sbjct: 99  PEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHT 150



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 11/21 (52%), Positives = 16/21 (76%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAG 325
           G +  SGS DKT+R+WD++ G
Sbjct: 309 GPFLASGSRDKTIRIWDVSVG 329


>AY069490-1|AAL39635.1|  576|Drosophila melanogaster LD21931p
           protein.
          Length = 576

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 27/92 (29%), Positives = 44/92 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GHN  ++ I   PK   ++LS S D  + +W++  +        +   GH   I D+
Sbjct: 280 TWSGHNKGISSIRWFPKTAHLLLSGSMDCRVKLWEVYGERRCI----RTFSGHRQAIKDI 335

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
             ++ G   LS S+D+ ++LWD   G    RF
Sbjct: 336 AWNNRGTNFLSASYDRYIKLWDAETGDVVSRF 367


>AE014297-3088|AAF55949.1|  576|Drosophila melanogaster CG6015-PA
           protein.
          Length = 576

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 27/92 (29%), Positives = 44/92 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GHN  ++ I   PK   ++LS S D  + +W++  +        +   GH   I D+
Sbjct: 280 TWSGHNKGISSIRWFPKTAHLLLSGSMDCRVKLWEVYGERRCI----RTFSGHRQAIKDI 335

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
             ++ G   LS S+D+ ++LWD   G    RF
Sbjct: 336 AWNNRGTNFLSASYDRYIKLWDAETGDVVSRF 367


>AY061388-1|AAL28936.1|  335|Drosophila melanogaster LD31217p
           protein.
          Length = 335

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 29/92 (31%), Positives = 45/92 (48%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           L L  TL+GH G +  +A +PK  ++  S   DK + +W LT   N +        GH  
Sbjct: 4   LILEHTLQGHKGRIWGVAWHPK-GNVFASCGEDKAIRIWSLTG--NTWSTKTILSDGHKR 60

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            I ++  S  G Y  S S+D T  +W  ++G+
Sbjct: 61  TIREIRWSPCGQYLASASFDATTAIWSKSSGE 92



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 22/93 (23%), Positives = 45/93 (48%)
 Frame = +2

Query: 32  FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK 211
           +SK S   +   TL GH   V  ++ + +   ++ + SRDK++ +W++  D+        
Sbjct: 86  WSKSSGEFECNATLEGHENEVKSVSWS-RSGGLLATCSRDKSVWIWEVAGDDEFECAAV- 143

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            L  H+  +  VV     +   S S+D T++++
Sbjct: 144 -LNPHTQDVKRVVWHPTKDILASASYDNTIKMF 175



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 21/81 (25%), Positives = 36/81 (44%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   + +I  +P     + S+S D T  +W  +  E         L GH + +  V  S
Sbjct: 57  GHKRTIREIRWSP-CGQYLASASFDATTAIWSKSSGEFECNAT---LEGHENEVKSVSWS 112

Query: 257 SDGNYALSGSWDKTLRLWDLA 319
             G    + S DK++ +W++A
Sbjct: 113 RSGGLLATCSRDKSVWIWEVA 133



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 19/80 (23%), Positives = 39/80 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L  H   V ++  +P   D++ S+S D T+ ++     +N++      L  H+  +  + 
Sbjct: 144 LNPHTQDVKRVVWHPT-KDILASASYDNTIKMFAEEPIDNDWDCTAT-LTSHTSTVWGID 201

Query: 251 LSSDGNYALSGSWDKTLRLW 310
             +DG   +S S D T+++W
Sbjct: 202 FDADGERLVSCSDDTTIKIW 221


>AE013599-1967|AAF58195.1|  335|Drosophila melanogaster CG12797-PA
           protein.
          Length = 335

 Score = 50.0 bits (114), Expect = 3e-06
 Identities = 29/92 (31%), Positives = 45/92 (48%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           L L  TL+GH G +  +A +PK  ++  S   DK + +W LT   N +        GH  
Sbjct: 4   LILEHTLQGHKGRIWGVAWHPK-GNVFASCGEDKAIRIWSLTG--NTWSTKTILSDGHKR 60

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
            I ++  S  G Y  S S+D T  +W  ++G+
Sbjct: 61  TIREIRWSPCGQYLASASFDATTAIWSKSSGE 92



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 22/93 (23%), Positives = 45/93 (48%)
 Frame = +2

Query: 32  FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK 211
           +SK S   +   TL GH   V  ++ + +   ++ + SRDK++ +W++  D+        
Sbjct: 86  WSKSSGEFECNATLEGHENEVKSVSWS-RSGGLLATCSRDKSVWIWEVAGDDEFECAAV- 143

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
            L  H+  +  VV     +   S S+D T++++
Sbjct: 144 -LNPHTQDVKRVVWHPTKDILASASYDNTIKMF 175



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 21/81 (25%), Positives = 36/81 (44%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   + +I  +P     + S+S D T  +W  +  E         L GH + +  V  S
Sbjct: 57  GHKRTIREIRWSP-CGQYLASASFDATTAIWSKSSGEFECNAT---LEGHENEVKSVSWS 112

Query: 257 SDGNYALSGSWDKTLRLWDLA 319
             G    + S DK++ +W++A
Sbjct: 113 RSGGLLATCSRDKSVWIWEVA 133



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 19/80 (23%), Positives = 39/80 (48%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L  H   V ++  +P   D++ S+S D T+ ++     +N++      L  H+  +  + 
Sbjct: 144 LNPHTQDVKRVVWHPT-KDILASASYDNTIKMFAEEPIDNDWDCTAT-LTSHTSTVWGID 201

Query: 251 LSSDGNYALSGSWDKTLRLW 310
             +DG   +S S D T+++W
Sbjct: 202 FDADGERLVSCSDDTTIKIW 221


>AY089286-1|AAL90024.1|  488|Drosophila melanogaster AT08344p
           protein.
          Length = 488

 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 27/85 (31%), Positives = 43/85 (50%)
 Frame = +2

Query: 104 ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSG 283
           A  P   + ++S S D TL +W+     NN     +R+ GH + ++DV  S D     S 
Sbjct: 339 AVCPDEVESLVSCSDDNTLYLWR-----NNQNKCVERMTGHQNVVNDVKYSPDVKLIASA 393

Query: 284 SWDKTLRLWDLAAGKTTRRFEDHTK 358
           S+DK++RLW  + G+    F  H +
Sbjct: 394 SFDKSVRLWRASDGQYMATFRGHVQ 418



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 25/94 (26%), Positives = 43/94 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V  +  +P    +I S+S DK++ +W+ +  +  Y        GH   +  V 
Sbjct: 371 MTGHQNVVNDVKYSPDVK-LIASASFDKSVRLWRAS--DGQY---MATFRGHVQAVYTVA 424

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S+D    +SGS D TL++W +   K  +    H
Sbjct: 425 WSADSRLIVSGSKDSTLKVWSVQTKKLAQELPGH 458



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/81 (32%), Positives = 40/81 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T RGH   V  +A +     +I+S S+D TL VW +   +    +P     GH+  +  V
Sbjct: 412 TFRGHVQAVYTVAWSAD-SRLIVSGSKDSTLKVWSVQTKKLAQELP-----GHADEVFGV 465

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
             + DG+   SG  DK ++LW
Sbjct: 466 DWAPDGSRVASGGKDKVIKLW 486



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH+  +  +  S DG +  SGS D T+RLWDL
Sbjct: 117 GHAEAVVSLNFSPDGAHLASGSGDTTVRLWDL 148



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 18/64 (28%), Positives = 35/64 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   VT +        +I +SS+D+T+ +W+        GI  +   GH+H+++++ 
Sbjct: 247 IAGHTNAVTAVRWGGA--GLIYTSSKDRTVKMWRAAD-----GILCRTFSGHAHWVNNIA 299

Query: 251 LSSD 262
           LS+D
Sbjct: 300 LSTD 303



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 24/101 (23%), Positives = 40/101 (39%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K+    +   ++ GH   V  +  +P    +  S S D T+ +W L     N   P    
Sbjct: 104 KVRPVTRCTSSMPGHAEAVVSLNFSPDGAHLA-SGSGDTTVRLWDL-----NTETPHFTC 157

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
            GH  ++  V  + DG    SG    ++ +WD   G+   R
Sbjct: 158 TGHKQWVLCVSWAPDGKRLASGCKAGSIIIWDPETGQQKGR 198



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 5/107 (4%)
 Frame = +2

Query: 47  ETLKLRGT-LRGHNGWVTQIATNPKYPD----MILSSSRDKTLIVWKLTRDENNYGIPQK 211
           ET + +G  L GH   +  +A  P + D     + S+S D    +W +       G    
Sbjct: 191 ETGQQKGRPLSGHKKHINCLAWEPYHRDPECRKLASASGDGDCRIWDV-----KLGQCLM 245

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + GH++ ++ V     G    + S D+T+++W  A G   R F  H
Sbjct: 246 NIAGHTNAVTAVRWGGAG-LIYTSSKDRTVKMWRAADGILCRTFSGH 291


>AJ012588-1|CAA10070.1|  480|Drosophila melanogaster Notchless
           protein protein.
          Length = 480

 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 27/85 (31%), Positives = 43/85 (50%)
 Frame = +2

Query: 104 ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSG 283
           A  P   + ++S S D TL +W+     NN     +R+ GH + ++DV  S D     S 
Sbjct: 331 AVCPDEVESLVSCSDDNTLYLWR-----NNQNKCVERMTGHQNVVNDVKYSPDVKLIASA 385

Query: 284 SWDKTLRLWDLAAGKTTRRFEDHTK 358
           S+DK++RLW  + G+    F  H +
Sbjct: 386 SFDKSVRLWRASDGQYMATFRGHVQ 410



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 25/94 (26%), Positives = 43/94 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V  +  +P    +I S+S DK++ +W+ +  +  Y        GH   +  V 
Sbjct: 363 MTGHQNVVNDVKYSPDVK-LIASASFDKSVRLWRAS--DGQY---MATFRGHVQAVYTVA 416

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S+D    +SGS D TL++W +   K  +    H
Sbjct: 417 WSADSRLIVSGSKDSTLKVWSVQTKKLAQELPGH 450



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/81 (32%), Positives = 40/81 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T RGH   V  +A +     +I+S S+D TL VW +   +    +P     GH+  +  V
Sbjct: 404 TFRGHVQAVYTVAWSAD-SRLIVSGSKDSTLKVWSVQTKKLAQELP-----GHADEVFGV 457

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
             + DG+   SG  DK ++LW
Sbjct: 458 DWAPDGSRVASGGKDKVIKLW 478



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH+  +  +  S DG +  SGS D T+RLWDL
Sbjct: 109 GHAEAVVSLNFSPDGAHLASGSGDTTVRLWDL 140



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 17/64 (26%), Positives = 34/64 (53%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   VT +        +I +SS+D+T+ +W+        GI  +   G +H+++++ 
Sbjct: 239 IAGHTNAVTAVRWGGA--GLIYTSSKDRTVKMWRAAD-----GILCRTFSGQAHWVNNIA 291

Query: 251 LSSD 262
           LS+D
Sbjct: 292 LSTD 295



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 24/101 (23%), Positives = 40/101 (39%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K+    +   ++ GH   V  +  +P    +  S S D T+ +W L     N   P    
Sbjct: 96  KVRPVTRCTSSMPGHAEAVVSLNFSPDGAHLA-SGSGDTTVRLWDL-----NTETPHFTC 149

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
            GH  ++  V  + DG    SG    ++ +WD   G+   R
Sbjct: 150 TGHKQWVLCVSWAPDGKRLASGCKAGSIIIWDPETGQQKGR 190


>AE014134-128|AAF51479.2|  488|Drosophila melanogaster CG2863-PA
           protein.
          Length = 488

 Score = 49.2 bits (112), Expect = 5e-06
 Identities = 27/85 (31%), Positives = 43/85 (50%)
 Frame = +2

Query: 104 ATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSG 283
           A  P   + ++S S D TL +W+     NN     +R+ GH + ++DV  S D     S 
Sbjct: 339 AVCPDEVESLVSCSDDNTLYLWR-----NNQNKCVERMTGHQNVVNDVKYSPDVKLIASA 393

Query: 284 SWDKTLRLWDLAAGKTTRRFEDHTK 358
           S+DK++RLW  + G+    F  H +
Sbjct: 394 SFDKSVRLWRASDGQYMATFRGHVQ 418



 Score = 41.5 bits (93), Expect = 0.001
 Identities = 25/94 (26%), Positives = 43/94 (45%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   V  +  +P    +I S+S DK++ +W+ +  +  Y        GH   +  V 
Sbjct: 371 MTGHQNVVNDVKYSPDVK-LIASASFDKSVRLWRAS--DGQY---MATFRGHVQAVYTVA 424

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            S+D    +SGS D TL++W +   K  +    H
Sbjct: 425 WSADSRLIVSGSKDSTLKVWSVQTKKLAQELPGH 458



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 26/81 (32%), Positives = 40/81 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T RGH   V  +A +     +I+S S+D TL VW +   +    +P     GH+  +  V
Sbjct: 412 TFRGHVQAVYTVAWSAD-SRLIVSGSKDSTLKVWSVQTKKLAQELP-----GHADEVFGV 465

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
             + DG+   SG  DK ++LW
Sbjct: 466 DWAPDGSRVASGGKDKVIKLW 486



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 15/32 (46%), Positives = 20/32 (62%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH+  +  +  S DG +  SGS D T+RLWDL
Sbjct: 117 GHAEAVVSLNFSPDGAHLASGSGDTTVRLWDL 148



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 18/64 (28%), Positives = 35/64 (54%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH   VT +        +I +SS+D+T+ +W+        GI  +   GH+H+++++ 
Sbjct: 247 IAGHTNAVTAVRWGGA--GLIYTSSKDRTVKMWRAAD-----GILCRTFSGHAHWVNNIA 299

Query: 251 LSSD 262
           LS+D
Sbjct: 300 LSTD 303



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 24/101 (23%), Positives = 40/101 (39%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K+    +   ++ GH   V  +  +P    +  S S D T+ +W L     N   P    
Sbjct: 104 KVRPVTRCTSSMPGHAEAVVSLNFSPDGAHLA-SGSGDTTVRLWDL-----NTETPHFTC 157

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRR 340
            GH  ++  V  + DG    SG    ++ +WD   G+   R
Sbjct: 158 TGHKQWVLCVSWAPDGKRLASGCKAGSIIIWDPETGQQKGR 198



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 5/107 (4%)
 Frame = +2

Query: 47  ETLKLRGT-LRGHNGWVTQIATNPKYPD----MILSSSRDKTLIVWKLTRDENNYGIPQK 211
           ET + +G  L GH   +  +A  P + D     + S+S D    +W +       G    
Sbjct: 191 ETGQQKGRPLSGHKKHINCLAWEPYHRDPECRKLASASGDGDCRIWDV-----KLGQCLM 245

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
            + GH++ ++ V     G    + S D+T+++W  A G   R F  H
Sbjct: 246 NIAGHTNAVTAVRWGGAG-LIYTSSKDRTVKMWRAADGILCRTFSGH 291


>BT023906-1|ABA81840.1|  914|Drosophila melanogaster GH18655p
           protein.
          Length = 914

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 2/96 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH  +V QI  NPK  +   S+S D+T+ VW+L  +  N+      L GH   ++  D  
Sbjct: 140 GHTHYVMQIVFNPKDNNTFASASLDRTVKVWQLGSNFANF-----TLEGHEKGVNCVDYY 194

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              D  Y +SG+ D+ +++WD       +  E H +
Sbjct: 195 HGGDKPYLISGADDRLVKIWDYQNKTCVQTLEGHAQ 230



 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 1/104 (0%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           TL+   +   H+ ++  IA +P  P ++L+SS D  + +W     E  +   Q+   GH+
Sbjct: 88  TLEKVHSFEAHSDYLRCIAVHPTQP-LVLTSSDDMLIKLWNW---EKMWAC-QRVFEGHT 142

Query: 230 HFISDVVLS-SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H++  +V +  D N   S S D+T+++W L +       E H K
Sbjct: 143 HYVMQIVFNPKDNNTFASASLDRTVKVWQLGSNFANFTLEGHEK 186



 Score = 28.7 bits (61), Expect = 6.8
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++S + D+ + +W    D  N    Q  L GH+  IS V    +    L+GS D T+R+W
Sbjct: 202 LISGADDRLVKIW----DYQNKTCVQT-LEGHAQNISAVCFHPELPIVLTGSEDGTVRIW 256


>AJ006524-1|CAA07085.1|  914|Drosophila melanogaster coatomer,
           beta-prime subunit protein.
          Length = 914

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 2/96 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH  +V QI  NPK  +   S+S D+T+ VW+L  +  N+      L GH   ++  D  
Sbjct: 140 GHTHYVMQIVFNPKDNNTFASASLDRTVKVWQLGSNFANF-----TLEGHEKGVNCVDYY 194

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              D  Y +SG+ D+ +++WD       +  E H +
Sbjct: 195 HGGDKPYLISGADDRLVKIWDYQNKTCVQTLEGHAQ 230



 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 1/104 (0%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           TL+   +   H+ ++  IA +P  P ++L+SS D  + +W     E  +   Q+   GH+
Sbjct: 88  TLEKVHSFEAHSDYLRCIAVHPTQP-LVLTSSDDMLIKLWNW---EKMWAC-QRVFEGHT 142

Query: 230 HFISDVVLS-SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H++  +V +  D N   S S D+T+++W L +       E H K
Sbjct: 143 HYVMQIVFNPKDNNTFASASLDRTVKVWQLGSNFANFTLEGHEK 186


>AJ006523-1|CAA07084.1|  914|Drosophila melanogaster coatomer,
           beta-prime subunit protein.
          Length = 914

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 2/96 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH  +V QI  NPK  +   S+S D+T+ VW+L  +  N+      L GH   ++  D  
Sbjct: 140 GHTHYVMQIVFNPKDNNTFASASLDRTVKVWQLGSNFANF-----TLEGHEKGVNCVDYY 194

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              D  Y +SG+ D+ +++WD       +  E H +
Sbjct: 195 HGGDKPYLISGADDRLVKIWDYQNKTCVQTLEGHAQ 230



 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 1/104 (0%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           TL+   +   H+ ++  IA +P  P ++L+SS D  + +W     E  +   Q+   GH+
Sbjct: 88  TLEKVHSFEAHSDYLRCIAVHPTQP-LVLTSSDDMLIKLWNW---EKMWAC-QRVFEGHT 142

Query: 230 HFISDVVLS-SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H++  +V +  D N   S S D+T+++W L +       E H K
Sbjct: 143 HYVMQIVFNPKDNNTFASASLDRTVKVWQLGSNFANFTLEGHEK 186


>AE014134-2340|AAF53294.2|  914|Drosophila melanogaster CG6699-PA
           protein.
          Length = 914

 Score = 48.8 bits (111), Expect = 6e-06
 Identities = 29/96 (30%), Positives = 47/96 (48%), Gaps = 2/96 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS--DVV 250
           GH  +V QI  NPK  +   S+S D+T+ VW+L  +  N+      L GH   ++  D  
Sbjct: 140 GHTHYVMQIVFNPKDNNTFASASLDRTVKVWQLGSNFANF-----TLEGHEKGVNCVDYY 194

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
              D  Y +SG+ D+ +++WD       +  E H +
Sbjct: 195 HGGDKPYLISGADDRLVKIWDYQNKTCVQTLEGHAQ 230



 Score = 48.4 bits (110), Expect = 8e-06
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 1/104 (0%)
 Frame = +2

Query: 50  TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHS 229
           TL+   +   H+ ++  IA +P  P ++L+SS D  + +W     E  +   Q+   GH+
Sbjct: 88  TLEKVHSFEAHSDYLRCIAVHPTQP-LVLTSSDDMLIKLWNW---EKMWAC-QRVFEGHT 142

Query: 230 HFISDVVLS-SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           H++  +V +  D N   S S D+T+++W L +       E H K
Sbjct: 143 HYVMQIVFNPKDNNTFASASLDRTVKVWQLGSNFANFTLEGHEK 186



 Score = 28.7 bits (61), Expect = 6.8
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           ++S + D+ + +W    D  N    Q  L GH+  IS V    +    L+GS D T+R+W
Sbjct: 202 LISGADDRLVKIW----DYQNKTCVQT-LEGHAQNISAVCFHPELPIVLTGSEDGTVRIW 256


>AY069349-1|AAL39494.1|  391|Drosophila melanogaster LD05671p
           protein.
          Length = 391

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 29/94 (30%), Positives = 44/94 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+G +TQ+   P     I +SS D T+I+W L     N      R   HS  ++ V  S
Sbjct: 16  GHSGGITQLRFGPDGAQ-IATSSTDSTVILWNL-----NQAARCIRFASHSAPVNGVAWS 69

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             GN   S   D+T+++W+      +  F  H+K
Sbjct: 70  PKGNLVASAGHDRTVKIWEPKLRGVSGEFVAHSK 103



 Score = 37.5 bits (83), Expect = 0.015
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS  ++DV     G++ LSGS D+T+R+ DL  G+       HT
Sbjct: 227 HSAPVNDVAFHPSGHFLLSGSDDRTIRILDLLEGRPIYTLTGHT 270



 Score = 34.7 bits (76), Expect = 0.10
 Identities = 17/74 (22%), Positives = 41/74 (55%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++L++S DK+  +W++ R +      Q+     ++++     S +G    + S DK++R+
Sbjct: 116 LMLTASDDKSAKIWRVARRQFVSSFAQQ-----NNWVRSAKFSPNGKLVATASDDKSVRI 170

Query: 308 WDLAAGKTTRRFED 349
           +D+ +G+  R F +
Sbjct: 171 YDVDSGECVRTFTE 184



 Score = 34.7 bits (76), Expect = 0.10
 Identities = 23/77 (29%), Positives = 37/77 (48%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+  V  +A +P     +LS S D+T+ +  L       G P   L GH+  ++ V  S 
Sbjct: 227 HSAPVNDVAFHPS-GHFLLSGSDDRTIRILDLLE-----GRPIYTLTGHTDAVNAVAFSR 280

Query: 260 DGNYALSGSWDKTLRLW 310
           DG+   +G  D+ L +W
Sbjct: 281 DGDKFATGGSDRQLLVW 297



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 21/80 (26%), Positives = 41/80 (51%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+  V  +A +PK  +++ S+  D+T+ +W    +    G+  +    HS  +  V   S
Sbjct: 59  HSAPVNGVAWSPK-GNLVASAGHDRTVKIW----EPKLRGVSGE-FVAHSKAVRSVDFDS 112

Query: 260 DGNYALSGSWDKTLRLWDLA 319
            G+  L+ S DK+ ++W +A
Sbjct: 113 TGHLMLTASDDKSAKIWRVA 132



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++   GHS  I+ +    DG    + S D T+ LW+L       RF  H+
Sbjct: 11  ERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIRFASHS 60


>AE014296-2267|AAF49825.1|  391|Drosophila melanogaster CG10191-PA
           protein.
          Length = 391

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 29/94 (30%), Positives = 44/94 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH+G +TQ+   P     I +SS D T+I+W L     N      R   HS  ++ V  S
Sbjct: 16  GHSGGITQLRFGPDGAQ-IATSSTDSTVILWNL-----NQAARCIRFASHSAPVNGVAWS 69

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             GN   S   D+T+++W+      +  F  H+K
Sbjct: 70  PKGNLVASAGHDRTVKIWEPKLRGVSGEFVAHSK 103



 Score = 37.5 bits (83), Expect = 0.015
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           HS  ++DV     G++ LSGS D+T+R+ DL  G+       HT
Sbjct: 227 HSAPVNDVAFHPSGHFLLSGSDDRTIRILDLLEGRPIYTLTGHT 270



 Score = 34.7 bits (76), Expect = 0.10
 Identities = 17/74 (22%), Positives = 41/74 (55%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           ++L++S DK+  +W++ R +      Q+     ++++     S +G    + S DK++R+
Sbjct: 116 LMLTASDDKSAKIWRVARRQFVSSFAQQ-----NNWVRSAKFSPNGKLVATASDDKSVRI 170

Query: 308 WDLAAGKTTRRFED 349
           +D+ +G+  R F +
Sbjct: 171 YDVDSGECVRTFTE 184



 Score = 34.7 bits (76), Expect = 0.10
 Identities = 23/77 (29%), Positives = 37/77 (48%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+  V  +A +P     +LS S D+T+ +  L       G P   L GH+  ++ V  S 
Sbjct: 227 HSAPVNDVAFHPS-GHFLLSGSDDRTIRILDLLE-----GRPIYTLTGHTDAVNAVAFSR 280

Query: 260 DGNYALSGSWDKTLRLW 310
           DG+   +G  D+ L +W
Sbjct: 281 DGDKFATGGSDRQLLVW 297



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 21/80 (26%), Positives = 41/80 (51%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+  V  +A +PK  +++ S+  D+T+ +W    +    G+  +    HS  +  V   S
Sbjct: 59  HSAPVNGVAWSPK-GNLVASAGHDRTVKIW----EPKLRGVSGE-FVAHSKAVRSVDFDS 112

Query: 260 DGNYALSGSWDKTLRLWDLA 319
            G+  L+ S DK+ ++W +A
Sbjct: 113 TGHLMLTASDDKSAKIWRVA 132



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/50 (30%), Positives = 23/50 (46%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           ++   GHS  I+ +    DG    + S D T+ LW+L       RF  H+
Sbjct: 11  ERHFTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIRFASHS 60


>AF071881-1|AAC64041.1|  454|Drosophila melanogaster Hira isoform
           protein.
          Length = 454

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 33/107 (30%), Positives = 55/107 (51%), Gaps = 3/107 (2%)
 Frame = +2

Query: 2   ASGXSSLFKP--FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWK 172
           ++G S +F      K  E+ K   TLRGH+G V  +A +P   D+ L+S S D T+I+W 
Sbjct: 117 SAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAWSPN--DVYLASCSIDNTVIIW- 173

Query: 173 LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
              D  ++      L GH+  +  V     G +  S S D+++++W+
Sbjct: 174 ---DARHFHNSVATLEGHTGLVKGVSWDPLGRFLASQSDDRSIKIWN 217


>U06460-1|AAC46481.1|  704|Drosophila melanogaster transcription
           initiation factorTFIID 85 kDa subunit protein.
          Length = 704

 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH G V + A  P+  +++LS S D T+ +W L        +   R  GH + + DV
Sbjct: 445 SLMGHTGPVYRCAFAPEM-NLLLSCSEDSTIRLWSLLTWSC---VVTYR--GHVYPVWDV 498

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +  G Y +S S+DKT RLW   + +  R F  H
Sbjct: 499 RFAPHGYYFVSCSYDKTARLWATDSNQALRVFVGH 533



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/93 (27%), Positives = 43/93 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +P   + + + S D+T+ +W     +N  G   + + GH   +S +  S
Sbjct: 532 GHLSDVDCVQFHPN-SNYVATGSSDRTVRLW-----DNMTGQSVRLMTGHKGSVSSLAFS 585

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + G Y  SGS D  + +WDL+ G        HT
Sbjct: 586 ACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHT 618



 Score = 34.7 bits (76), Expect = 0.10
 Identities = 22/81 (27%), Positives = 35/81 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH G V+ +A +      + S S D  +I+W L+      G     L  H+  ++ + 
Sbjct: 572 MTGHKGSVSSLAFSA-CGRYLASGSVDHNIIIWDLSN-----GSLVTTLLRHTSTVTTIT 625

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            S DG    +   D  L LWD
Sbjct: 626 FSRDGTVLAAAGLDNNLTLWD 646



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 15/56 (26%), Positives = 24/56 (42%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++  G   + L GH+  +     + + N  LS S D T+RLW L        +  H
Sbjct: 436 DDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGH 491


>AY118898-1|AAM50758.1|  510|Drosophila melanogaster LD08669p
           protein.
          Length = 510

 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 33/103 (32%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 323 ITLRRVLVGHRAAVNVVDFDEKY---IVSASGDRTIKVWSTSSCEF-----VRTLNGHKR 374

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D ++RLWD+  G   R  E H ++
Sbjct: 375 GIA--CLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEEL 415



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKR-LYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           M+++ S+D+++ VW +T       I  +R L GH   ++  V+  D  Y +S S D+T++
Sbjct: 302 MMVTCSKDRSIAVWDMTSPSE---ITLRRVLVGHRAAVN--VVDFDEKYIVSASGDRTIK 356

Query: 305 LWDLAAGKTTRRFEDHTK 358
           +W  ++ +  R    H +
Sbjct: 357 VWSTSSCEFVRTLNGHKR 374



 Score = 36.3 bits (80), Expect = 0.034
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +2

Query: 116 KYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           +Y D  I+S  RD T+ +W  T  +       K L GH+  +  + L  D    +SGS D
Sbjct: 217 QYDDGKIVSGLRDNTIKIWDRTDLQC-----VKTLMGHTGSV--LCLQYDDKVIISGSSD 269

Query: 293 KTLRLWDLAAGKTTRRFEDH 352
            T+R+WD+  G+       H
Sbjct: 270 STVRVWDVNTGEMVNTLIHH 289


>AY051960-1|AAK93384.1|  704|Drosophila melanogaster LD42828p
           protein.
          Length = 704

 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH G V + A  P+  +++LS S D T+ +W L        +   R  GH + + DV
Sbjct: 445 SLMGHTGPVYRCAFAPEM-NLLLSCSEDSTIRLWSLLTWSC---VVTYR--GHVYPVWDV 498

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +  G Y +S S+DKT RLW   + +  R F  H
Sbjct: 499 RFAPHGYYFVSCSYDKTARLWATDSNQALRVFVGH 533



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/93 (27%), Positives = 43/93 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +P   + + + S D+T+ +W     +N  G   + + GH   +S +  S
Sbjct: 532 GHLSDVDCVQFHPN-SNYVATGSSDRTVRLW-----DNMTGQSVRLMTGHKGSVSSLAFS 585

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + G Y  SGS D  + +WDL+ G        HT
Sbjct: 586 ACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHT 618



 Score = 34.7 bits (76), Expect = 0.10
 Identities = 22/81 (27%), Positives = 35/81 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH G V+ +A +      + S S D  +I+W L+      G     L  H+  ++ + 
Sbjct: 572 MTGHKGSVSSLAFSA-CGRYLASGSVDHNIIIWDLSN-----GSLVTTLLRHTSTVTTIT 625

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            S DG    +   D  L LWD
Sbjct: 626 FSRDGTVLAAAGLDNNLTLWD 646



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 15/56 (26%), Positives = 24/56 (42%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++  G   + L GH+  +     + + N  LS S D T+RLW L        +  H
Sbjct: 436 DDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGH 491


>AF222924-1|AAF63214.1|  510|Drosophila melanogaster Slimb protein.
          Length = 510

 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 33/103 (32%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 323 ITLRRVLVGHRAAVNVVDFDEKY---IVSASGDRTIKVWSTSSCEF-----VRTLNGHKR 374

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D ++RLWD+  G   R  E H ++
Sbjct: 375 GIA--CLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEEL 415



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKR-LYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           M+++ S+D+++ VW +T       I  +R L GH   ++  V+  D  Y +S S D+T++
Sbjct: 302 MMVTCSKDRSIAVWDMTSPSE---ITLRRVLVGHRAAVN--VVDFDEKYIVSASGDRTIK 356

Query: 305 LWDLAAGKTTRRFEDHTK 358
           +W  ++ +  R    H +
Sbjct: 357 VWSTSSCEFVRTLNGHKR 374



 Score = 36.3 bits (80), Expect = 0.034
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +2

Query: 116 KYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           +Y D  I+S  RD T+ +W  T  +       K L GH+  +  + L  D    +SGS D
Sbjct: 217 QYDDGKIVSGLRDNTIKIWDRTDLQC-----VKTLMGHTGSV--LCLQYDDKVIISGSSD 269

Query: 293 KTLRLWDLAAGKTTRRFEDH 352
            T+R+WD+  G+       H
Sbjct: 270 STVRVWDVNTGEMVNTLIHH 289


>AF222923-1|AAF63213.1|  510|Drosophila melanogaster Slimb protein.
          Length = 510

 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 33/103 (32%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 323 ITLRRVLVGHRAAVNVVDFDEKY---IVSASGDRTIKVWSTSSCEF-----VRTLNGHKR 374

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D ++RLWD+  G   R  E H ++
Sbjct: 375 GIA--CLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEEL 415



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKR-LYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           M+++ S+D+++ VW +T       I  +R L GH   ++  V+  D  Y +S S D+T++
Sbjct: 302 MMVTCSKDRSIAVWDMTSPSE---ITLRRVLVGHRAAVN--VVDFDEKYIVSASGDRTIK 356

Query: 305 LWDLAAGKTTRRFEDHTK 358
           +W  ++ +  R    H +
Sbjct: 357 VWSTSSCEFVRTLNGHKR 374



 Score = 36.3 bits (80), Expect = 0.034
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +2

Query: 116 KYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           +Y D  I+S  RD T+ +W  T  +       K L GH+  +  + L  D    +SGS D
Sbjct: 217 QYDDGKIVSGLRDNTIKIWDRTDLQC-----VKTLMGHTGSV--LCLQYDDKVIISGSSD 269

Query: 293 KTLRLWDLAAGKTTRRFEDH 352
            T+R+WD+  G+       H
Sbjct: 270 STVRVWDVNTGEMVNTLIHH 289


>AF032878-1|AAC38852.1|  510|Drosophila melanogaster Slimb protein.
          Length = 510

 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 33/103 (32%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 323 ITLRRVLVGHRAAVNVVDFDEKY---IVSASGDRTIKVWSTSTCEF-----VRTLNGHKR 374

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D ++RLWD+  G   R  E H ++
Sbjct: 375 GIA--CLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEEL 415



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKR-LYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           M+++ S+D+++ VW +T       I  +R L GH   ++  V+  D  Y +S S D+T++
Sbjct: 302 MMVTCSKDRSIAVWDMTSPSE---ITLRRVLVGHRAAVN--VVDFDEKYIVSASGDRTIK 356

Query: 305 LWDLAAGKTTRRFEDHTK 358
           +W  +  +  R    H +
Sbjct: 357 VWSTSTCEFVRTLNGHKR 374



 Score = 36.3 bits (80), Expect = 0.034
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +2

Query: 116 KYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           +Y D  I+S  RD T+ +W  T  +       K L GH+  +  + L  D    +SGS D
Sbjct: 217 QYDDGKIVSGLRDNTIKIWDRTDLQC-----VKTLMGHTGSV--LCLQYDDKVIISGSSD 269

Query: 293 KTLRLWDLAAGKTTRRFEDH 352
            T+R+WD+  G+       H
Sbjct: 270 STVRVWDVNTGEMVNTLIHH 289


>AE014297-2934|AAF55853.1|  510|Drosophila melanogaster CG3412-PA
           protein.
          Length = 510

 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 33/103 (32%), Positives = 49/103 (47%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSH 232
           + LR  L GH   V  +  + KY   I+S+S D+T+ VW  +  E       + L GH  
Sbjct: 323 ITLRRVLVGHRAAVNVVDFDEKY---IVSASGDRTIKVWSTSSCEF-----VRTLNGHKR 374

Query: 233 FISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
            I+   L       +SGS D ++RLWD+  G   R  E H ++
Sbjct: 375 GIA--CLQYRDRLVVSGSSDNSIRLWDIECGACLRVLEGHEEL 415



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 1/78 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKR-LYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           M+++ S+D+++ VW +T       I  +R L GH   ++  V+  D  Y +S S D+T++
Sbjct: 302 MMVTCSKDRSIAVWDMTSPSE---ITLRRVLVGHRAAVN--VVDFDEKYIVSASGDRTIK 356

Query: 305 LWDLAAGKTTRRFEDHTK 358
           +W  ++ +  R    H +
Sbjct: 357 VWSTSSCEFVRTLNGHKR 374



 Score = 36.3 bits (80), Expect = 0.034
 Identities = 25/80 (31%), Positives = 38/80 (47%), Gaps = 1/80 (1%)
 Frame = +2

Query: 116 KYPD-MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           +Y D  I+S  RD T+ +W  T  +       K L GH+  +  + L  D    +SGS D
Sbjct: 217 QYDDGKIVSGLRDNTIKIWDRTDLQC-----VKTLMGHTGSV--LCLQYDDKVIISGSSD 269

Query: 293 KTLRLWDLAAGKTTRRFEDH 352
            T+R+WD+  G+       H
Sbjct: 270 STVRVWDVNTGEMVNTLIHH 289


>AE013599-1190|AAF58737.1|  704|Drosophila melanogaster CG7704-PA
           protein.
          Length = 704

 Score = 45.6 bits (103), Expect = 6e-05
 Identities = 32/95 (33%), Positives = 48/95 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH G V + A  P+  +++LS S D T+ +W L        +   R  GH + + DV
Sbjct: 445 SLMGHTGPVYRCAFAPEM-NLLLSCSEDSTIRLWSLLTWSC---VVTYR--GHVYPVWDV 498

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +  G Y +S S+DKT RLW   + +  R F  H
Sbjct: 499 RFAPHGYYFVSCSYDKTARLWATDSNQALRVFVGH 533



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/93 (27%), Positives = 43/93 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +  +P   + + + S D+T+ +W     +N  G   + + GH   +S +  S
Sbjct: 532 GHLSDVDCVQFHPN-SNYVATGSSDRTVRLW-----DNMTGQSVRLMTGHKGSVSSLAFS 585

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           + G Y  SGS D  + +WDL+ G        HT
Sbjct: 586 ACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHT 618



 Score = 34.7 bits (76), Expect = 0.10
 Identities = 22/81 (27%), Positives = 35/81 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           + GH G V+ +A +      + S S D  +I+W L+      G     L  H+  ++ + 
Sbjct: 572 MTGHKGSVSSLAFSA-CGRYLASGSVDHNIIIWDLSN-----GSLVTTLLRHTSTVTTIT 625

Query: 251 LSSDGNYALSGSWDKTLRLWD 313
            S DG    +   D  L LWD
Sbjct: 626 FSRDGTVLAAAGLDNNLTLWD 646



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 15/56 (26%), Positives = 24/56 (42%)
 Frame = +2

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           ++  G   + L GH+  +     + + N  LS S D T+RLW L        +  H
Sbjct: 436 DDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGH 491


>BT025112-1|ABE73283.1|  345|Drosophila melanogaster IP10415p
           protein.
          Length = 345

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 35/114 (30%), Positives = 57/114 (50%)
 Frame = +2

Query: 17  SLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNY 196
           S F   + MS    ++ +L GH+G VT +  +    +++ SSS D+ L +W L+      
Sbjct: 34  SQFHLENSMSPGYAIKHSLLGHSGCVTGLKFSSNGENLV-SSSGDRLLKLWDLSATRCI- 91

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
               + L GH   ++DV  S+ G  A S S D T+RLWD  +    +  E H++
Sbjct: 92  ----QSLAGHGDGVNDVAWSAAGLIA-SCSDDMTVRLWDARSKLCVKVLEGHSR 140



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 30/95 (31%), Positives = 45/95 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +A +     +I S S D T+ +W   R +    +  K L GHS +    
Sbjct: 93  SLAGHGDGVNDVAWSAA--GLIASCSDDMTVRLWD-ARSK----LCVKVLEGHSRYSFSC 145

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +   N   S S+D+T+RLWD+  GKT +    H
Sbjct: 146 CFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAH 180



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/93 (27%), Positives = 46/93 (49%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +      NP+  +++ S+S D+T+ +W +       G   K ++ H   I+ V 
Sbjct: 135 LEGHSRYSFSCCFNPQ-ANLLASTSFDETVRLWDVRT-----GKTLKIVHAHQDPITSVD 188

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
              DGN  ++ S+D  +RLWD + G   +   D
Sbjct: 189 FHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLVD 221



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +2

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           V  S +G Y LS + + TLRLW+    K  R +  H
Sbjct: 230 VKFSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGH 265


>AE013599-2552|AAF57798.2|  345|Drosophila melanogaster CG10931-PA
           protein.
          Length = 345

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 35/114 (30%), Positives = 57/114 (50%)
 Frame = +2

Query: 17  SLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNY 196
           S F   + MS    ++ +L GH+G VT +  +    +++ SSS D+ L +W L+      
Sbjct: 34  SQFHLENSMSPGYAIKHSLLGHSGCVTGLKFSSNGENLV-SSSGDRLLKLWDLSATRCI- 91

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
               + L GH   ++DV  S+ G  A S S D T+RLWD  +    +  E H++
Sbjct: 92  ----QSLAGHGDGVNDVAWSAAGLIA-SCSDDMTVRLWDARSKLCVKVLEGHSR 140



 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 30/95 (31%), Positives = 45/95 (47%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L GH   V  +A +     +I S S D T+ +W   R +    +  K L GHS +    
Sbjct: 93  SLAGHGDGVNDVAWSAA--GLIASCSDDMTVRLWD-ARSK----LCVKVLEGHSRYSFSC 145

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             +   N   S S+D+T+RLWD+  GKT +    H
Sbjct: 146 CFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAH 180



 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 26/93 (27%), Positives = 46/93 (49%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH+ +      NP+  +++ S+S D+T+ +W +       G   K ++ H   I+ V 
Sbjct: 135 LEGHSRYSFSCCFNPQ-ANLLASTSFDETVRLWDVRT-----GKTLKIVHAHQDPITSVD 188

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
              DGN  ++ S+D  +RLWD + G   +   D
Sbjct: 189 FHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLVD 221



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 14/36 (38%), Positives = 19/36 (52%)
 Frame = +2

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           V  S +G Y LS + + TLRLW+    K  R +  H
Sbjct: 230 VKFSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGH 265


>BT016167-1|AAV37052.1| 1047|Drosophila melanogaster AT04626p
           protein.
          Length = 1047

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 33/107 (30%), Positives = 54/107 (50%), Gaps = 3/107 (2%)
 Frame = +2

Query: 2   ASGXSSLFKP--FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWK 172
           ++G S +F      K  E+ K   TLRGH+G V  +A +P   D+ L+S S D T+I+W 
Sbjct: 100 SAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAWSPN--DVYLASCSIDNTVIIW- 156

Query: 173 LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
              D   +      L GH+  +  V     G +  S S D+++++W+
Sbjct: 157 ---DAQAFPHSVATLKGHTGLVKGVSWDPLGRFLASQSDDRSIKIWN 200


>AY069414-1|AAL39559.1|  437|Drosophila melanogaster LD11036p
           protein.
          Length = 437

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 33/107 (30%), Positives = 54/107 (50%), Gaps = 3/107 (2%)
 Frame = +2

Query: 2   ASGXSSLFKP--FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWK 172
           ++G S +F      K  E+ K   TLRGH+G V  +A +P   D+ L+S S D T+I+W 
Sbjct: 100 SAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAWSPN--DVYLASCSIDNTVIIW- 156

Query: 173 LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
              D   +      L GH+  +  V     G +  S S D+++++W+
Sbjct: 157 ---DAQAFPHSVATLKGHTGLVKGVSWDPLGRFLASQSDDRSIKIWN 200


>AJ222709-1|CAA10954.1| 1047|Drosophila melanogaster HIRA protein.
          Length = 1047

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 33/107 (30%), Positives = 54/107 (50%), Gaps = 3/107 (2%)
 Frame = +2

Query: 2   ASGXSSLFKP--FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWK 172
           ++G S +F      K  E+ K   TLRGH+G V  +A +P   D+ L+S S D T+I+W 
Sbjct: 100 SAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAWSPN--DVYLASCSIDNTVIIW- 156

Query: 173 LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
              D   +      L GH+  +  V     G +  S S D+++++W+
Sbjct: 157 ---DAQAFPHSVATLKGHTGLVKGVSWDPLGRFLASQSDDRSIKIWN 200


>AE014298-1052|AAF46267.1| 1047|Drosophila melanogaster CG12153-PA
           protein.
          Length = 1047

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 33/107 (30%), Positives = 54/107 (50%), Gaps = 3/107 (2%)
 Frame = +2

Query: 2   ASGXSSLFKP--FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWK 172
           ++G S +F      K  E+ K   TLRGH+G V  +A +P   D+ L+S S D T+I+W 
Sbjct: 100 SAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAWSPN--DVYLASCSIDNTVIIW- 156

Query: 173 LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
              D   +      L GH+  +  V     G +  S S D+++++W+
Sbjct: 157 ---DAQAFPHSVATLKGHTGLVKGVSWDPLGRFLASQSDDRSIKIWN 200


>BT025218-1|ABF17909.1|  668|Drosophila melanogaster FI01026p
           protein.
          Length = 668

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 26/95 (27%), Positives = 48/95 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L G    +  +A NP    +I+S S +  L +W     +    + + +L GH+  +  +
Sbjct: 161 SLTGSKDSIYSLAMNPS-GTVIVSGSTENILRIW-----DPRTCMRRMKLRGHTENVRCL 214

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           V+S DGN  +SGS D T+++W+L   +  +    H
Sbjct: 215 VVSPDGNQVVSGSSDGTIKVWNLGQQRCVQTIHVH 249



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 4/101 (3%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR----DENNYGIPQKRLYGHSHF 235
           TLR H  +V  +A   K  + + S+  DK + +W +        +N  +    L G    
Sbjct: 110 TLRTHRDYVQALAY-AKDREQVASAGLDKAIFLWDVNTLTALTASNNTVTTSSLTGSKDS 168

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           I  + ++  G   +SGS +  LR+WD        +   HT+
Sbjct: 169 IYSLAMNPSGTVIVSGSTENILRIWDPRTCMRRMKLRGHTE 209



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S+ RD  + VW    D +   I  + +  H+ +++D+VL  +G   +S S D T+++W
Sbjct: 43  LYSAGRDAIIRVWNTRTDSSEKYI--QSMEHHNDWVNDIVLCCNGRNLISASCDTTVKVW 100

Query: 311 DLAAG---KTTRRFEDHTK 358
           +   G    T R   D+ +
Sbjct: 101 NAQKGFCMSTLRTHRDYVQ 119


>BT001736-1|AAN71491.1|  668|Drosophila melanogaster RE72568p
           protein.
          Length = 668

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 26/95 (27%), Positives = 48/95 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L G    +  +A NP    +I+S S +  L +W     +    + + +L GH+  +  +
Sbjct: 161 SLTGSKDSIYSLAMNPS-GTVIVSGSTENILRIW-----DPRTCMRRMKLRGHTENVRCL 214

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           V+S DGN  +SGS D T+++W+L   +  +    H
Sbjct: 215 VVSPDGNQVVSGSSDGTIKVWNLGQQRCVQTIHVH 249



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 4/101 (3%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR----DENNYGIPQKRLYGHSHF 235
           TLR H  +V  +A   K  + + S+  DK + +W +        +N  +    L G    
Sbjct: 110 TLRTHRDYVQALAY-AKDREQVASAGLDKAIFLWDVNTLTALTASNNTVTTSSLTGSKDS 168

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           I  + ++  G   +SGS +  LR+WD        +   HT+
Sbjct: 169 IYSLAMNPSGTVIVSGSTENILRIWDPRTCMRRMKLRGHTE 209



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S+ RD  + VW    D +   I  + +  H+ +++D+VL  +G   +S S D T+++W
Sbjct: 43  LYSAGRDAIIRVWNTRTDSSEKYI--QSMEHHNDWVNDIVLCCNGRNLISASCDTTVKVW 100

Query: 311 DLAAG---KTTRRFEDHTK 358
           +   G    T R   D+ +
Sbjct: 101 NAQKGFCMSTLRTHRDYVQ 119


>AY089556-1|AAL90294.1|  819|Drosophila melanogaster LD44201p
           protein.
          Length = 819

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 28/96 (29%), Positives = 46/96 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+  TL GH   V  +  NP   + ++S S D T+ +W + ++ENN     K   GH   
Sbjct: 93  KIYSTLNGHMKSVRTLDFNPS-GEYVVSGSNDTTVRLWDV-QNENNC---IKVCRGHMSH 147

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++ V  S DG +  S   + ++ +WD+   K    F
Sbjct: 148 VNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEF 183



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIV-WKLTRDENNYGIPQKRLYGHSHFISD 244
           +L GHN  +  +     Y D  + S+ D  +I  W L    N+  I    L GH   +  
Sbjct: 55  SLTGHNRSIDCVRF--AYKDNFVYSADDIGIIRRWDL----NSQKI-YSTLNGHMKSVRT 107

Query: 245 VVLSSDGNYALSGSWDKTLRLWDL 316
           +  +  G Y +SGS D T+RLWD+
Sbjct: 108 LDFNPSGEYVVSGSNDTTVRLWDV 131


>AY075425-1|AAL68241.1| 1234|Drosophila melanogaster LD46584p
           protein.
          Length = 1234

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 26/84 (30%), Positives = 46/84 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H  +V  +A + +YP  ILS+S D+T+ +W   +  N   +    L GH+H++   
Sbjct: 88  TLLAHLDYVRTVAFHHEYP-WILSASDDQTIRIWNW-QSRNCICV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +  +S S D+T+R+WD++
Sbjct: 142 QFHPTEDQIVSASLDQTVRVWDIS 165



 Score = 37.1 bits (82), Expect = 0.019
 Identities = 21/86 (24%), Positives = 46/86 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++  L GH+  V   + +P  P +I+S + D+ + +W++  +   + +   R  GH + +
Sbjct: 200 VKHVLEGHDRGVNWASFHPTLP-LIVSGADDRLVKLWRMN-EYKAWEVDTCR--GHYNNV 255

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDL 316
           S V+     +  LS   D+++R+WD+
Sbjct: 256 SSVLFHPRQDLILSNGEDRSIRVWDM 281



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 14/38 (36%), Positives = 25/38 (65%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           T RGH   V+ +  +P+  D+ILS+  D+++ VW +T+
Sbjct: 247 TCRGHYNNVSSVLFHPRQ-DLILSNGEDRSIRVWDMTK 283


>AY061311-1|AAL28859.1|  313|Drosophila melanogaster LD23129p
           protein.
          Length = 313

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 31/114 (27%), Positives = 56/114 (49%)
 Frame = +2

Query: 17  SLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNY 196
           SL     KMS TL+    +  H+ ++ +   +P    ++L++S D T+ +WK T D + +
Sbjct: 193 SLTSQDQKMS-TLRPNRKIPAHSRYILRCKFSPD-SRLLLTTSGDGTVCIWK-TDDFSKW 249

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
               + L   ++++ D   S+D  +  + S D   RLW L    + R +  HTK
Sbjct: 250 ----RELCIENYWVWDAAFSADSKWLFTASSDGIARLWKLQTKSSIRDYTGHTK 299


>AJ011114-1|CAA09492.1| 1234|Drosophila melanogaster coatomer alpha
           subunit protein.
          Length = 1234

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 26/84 (30%), Positives = 46/84 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H  +V  +A + +YP  ILS+S D+T+ +W   +  N   +    L GH+H++   
Sbjct: 88  TLLAHLDYVRTVAFHHEYP-WILSASDDQTIRIWNW-QSRNCICV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +  +S S D+T+R+WD++
Sbjct: 142 QFHPTEDQIVSASLDQTVRVWDIS 165



 Score = 35.1 bits (77), Expect = 0.078
 Identities = 20/86 (23%), Positives = 45/86 (52%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++  L GH+      + +P  P +I+S + D+ + +W++  +   + +   R  GH + +
Sbjct: 200 VKHVLEGHDRGFNWASFHPTLP-LIVSGADDRLVKLWRMN-EYKAWEVDTCR--GHYNNV 255

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDL 316
           S V+     +  LS   D+++R+WD+
Sbjct: 256 SSVLFHPRQDLILSNGEDRSIRVWDM 281



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 14/38 (36%), Positives = 25/38 (65%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           T RGH   V+ +  +P+  D+ILS+  D+++ VW +T+
Sbjct: 247 TCRGHYNNVSSVLFHPRQ-DLILSNGEDRSIRVWDMTK 283


>AF031081-1|AAC48360.1| 1061|Drosophila melanogaster HIRA homolog
           protein.
          Length = 1061

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 33/107 (30%), Positives = 54/107 (50%), Gaps = 3/107 (2%)
 Frame = +2

Query: 2   ASGXSSLFKP--FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWK 172
           ++G S +F      K  E+ K   TLRGH+G V  +A +P   D+ L+S S D T+I+W 
Sbjct: 100 SAGSSGVFGTGGMQKNHESWKCFYTLRGHDGDVLDLAWSPN--DVYLASCSIDNTVIIW- 156

Query: 173 LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
              D   +      L GH+  +  V     G +  S S D+++++W+
Sbjct: 157 ---DAQAFPHSVATLKGHTGLVKGVWWDPLGRFLASQSDDRSIKIWN 200


>AE014298-2339|AAF48570.3|  819|Drosophila melanogaster CG13956-PB,
           isoform B protein.
          Length = 819

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 28/96 (29%), Positives = 46/96 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+  TL GH   V  +  NP   + ++S S D T+ +W + ++ENN     K   GH   
Sbjct: 93  KIYSTLNGHMKSVRTLDFNPS-GEYVVSGSNDTTVRLWDV-QNENNC---IKVCRGHMSH 147

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++ V  S DG +  S   + ++ +WD+   K    F
Sbjct: 148 VNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEF 183



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIV-WKLTRDENNYGIPQKRLYGHSHFISD 244
           +L GHN  +  +     Y D  + S+ D  +I  W L    N+  I    L GH   +  
Sbjct: 55  SLTGHNRSIDCVRF--AYKDNFVYSADDIGIIRRWDL----NSQKI-YSTLNGHMKSVRT 107

Query: 245 VVLSSDGNYALSGSWDKTLRLWDL 316
           +  +  G Y +SGS D T+RLWD+
Sbjct: 108 LDFNPSGEYVVSGSNDTTVRLWDV 131


>AE014298-2338|AAF48571.2|  819|Drosophila melanogaster CG13956-PA,
           isoform A protein.
          Length = 819

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 28/96 (29%), Positives = 46/96 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+  TL GH   V  +  NP   + ++S S D T+ +W + ++ENN     K   GH   
Sbjct: 93  KIYSTLNGHMKSVRTLDFNPS-GEYVVSGSNDTTVRLWDV-QNENNC---IKVCRGHMSH 147

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++ V  S DG +  S   + ++ +WD+   K    F
Sbjct: 148 VNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEF 183



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIV-WKLTRDENNYGIPQKRLYGHSHFISD 244
           +L GHN  +  +     Y D  + S+ D  +I  W L    N+  I    L GH   +  
Sbjct: 55  SLTGHNRSIDCVRF--AYKDNFVYSADDIGIIRRWDL----NSQKI-YSTLNGHMKSVRT 107

Query: 245 VVLSSDGNYALSGSWDKTLRLWDL 316
           +  +  G Y +SGS D T+RLWD+
Sbjct: 108 LDFNPSGEYVVSGSNDTTVRLWDV 131


>AE014298-1349|AAF46509.2|  313|Drosophila melanogaster CG3004-PA
           protein.
          Length = 313

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 31/114 (27%), Positives = 56/114 (49%)
 Frame = +2

Query: 17  SLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNY 196
           SL     KMS TL+    +  H+ ++ +   +P    ++L++S D T+ +WK T D + +
Sbjct: 193 SLTSQDQKMS-TLRPNRKIPAHSRYILRCKFSPD-SRLLLTTSGDGTVCIWK-TDDFSKW 249

Query: 197 GIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
               + L   ++++ D   S+D  +  + S D   RLW L    + R +  HTK
Sbjct: 250 ----RELCIENYWVWDAAFSADSKWLFTASSDGIARLWKLQTKSSIRDYTGHTK 299


>AE014296-317|AAF47535.1| 1234|Drosophila melanogaster CG7961-PB,
           isoform B protein.
          Length = 1234

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 26/84 (30%), Positives = 46/84 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H  +V  +A + +YP  ILS+S D+T+ +W   +  N   +    L GH+H++   
Sbjct: 88  TLLAHLDYVRTVAFHHEYP-WILSASDDQTIRIWNW-QSRNCICV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +  +S S D+T+R+WD++
Sbjct: 142 QFHPTEDQIVSASLDQTVRVWDIS 165



 Score = 37.1 bits (82), Expect = 0.019
 Identities = 21/86 (24%), Positives = 46/86 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++  L GH+  V   + +P  P +I+S + D+ + +W++  +   + +   R  GH + +
Sbjct: 200 VKHVLEGHDRGVNWASFHPTLP-LIVSGADDRLVKLWRMN-EYKAWEVDTCR--GHYNNV 255

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDL 316
           S V+     +  LS   D+++R+WD+
Sbjct: 256 SSVLFHPRQDLILSNGEDRSIRVWDM 281



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 14/38 (36%), Positives = 25/38 (65%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           T RGH   V+ +  +P+  D+ILS+  D+++ VW +T+
Sbjct: 247 TCRGHYNNVSSVLFHPRQ-DLILSNGEDRSIRVWDMTK 283


>AE014296-316|AAF47534.1| 1234|Drosophila melanogaster CG7961-PA,
           isoform A protein.
          Length = 1234

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 26/84 (30%), Positives = 46/84 (54%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL  H  +V  +A + +YP  ILS+S D+T+ +W   +  N   +    L GH+H++   
Sbjct: 88  TLLAHLDYVRTVAFHHEYP-WILSASDDQTIRIWNW-QSRNCICV----LTGHNHYVMCA 141

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
                 +  +S S D+T+R+WD++
Sbjct: 142 QFHPTEDQIVSASLDQTVRVWDIS 165



 Score = 37.1 bits (82), Expect = 0.019
 Identities = 21/86 (24%), Positives = 46/86 (53%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           ++  L GH+  V   + +P  P +I+S + D+ + +W++  +   + +   R  GH + +
Sbjct: 200 VKHVLEGHDRGVNWASFHPTLP-LIVSGADDRLVKLWRMN-EYKAWEVDTCR--GHYNNV 255

Query: 239 SDVVLSSDGNYALSGSWDKTLRLWDL 316
           S V+     +  LS   D+++R+WD+
Sbjct: 256 SSVLFHPRQDLILSNGEDRSIRVWDM 281



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 14/38 (36%), Positives = 25/38 (65%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           T RGH   V+ +  +P+  D+ILS+  D+++ VW +T+
Sbjct: 247 TCRGHYNNVSSVLFHPRQ-DLILSNGEDRSIRVWDMTK 283


>AE013599-1250|AAM68723.1|  668|Drosophila melanogaster CG9062-PB
           protein.
          Length = 668

 Score = 44.4 bits (100), Expect = 1e-04
 Identities = 26/95 (27%), Positives = 48/95 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +L G    +  +A NP    +I+S S +  L +W     +    + + +L GH+  +  +
Sbjct: 161 SLTGSKDSIYSLAMNPS-GTVIVSGSTENILRIW-----DPRTCMRRMKLRGHTENVRCL 214

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           V+S DGN  +SGS D T+++W+L   +  +    H
Sbjct: 215 VVSPDGNQVVSGSSDGTIKVWNLGQQRCVQTIHVH 249



 Score = 39.9 bits (89), Expect = 0.003
 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 4/101 (3%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR----DENNYGIPQKRLYGHSHF 235
           TLR H  +V  +A   K  + + S+  DK + +W +        +N  +    L G    
Sbjct: 110 TLRTHRDYVQALAY-AKDREQVASAGLDKAIFLWDVNTLTALTASNNTVTTSSLTGSKDS 168

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           I  + ++  G   +SGS +  LR+WD        +   HT+
Sbjct: 169 IYSLAMNPSGTVIVSGSTENILRIWDPRTCMRRMKLRGHTE 209



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 3/79 (3%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + S+ RD  + VW    D +   I  + +  H+ +++D+VL  +G   +S S D T+++W
Sbjct: 43  LYSAGRDAIIRVWNTRTDSSEKYI--QSMEHHNDWVNDIVLCCNGRNLISASCDTTVKVW 100

Query: 311 DLAAG---KTTRRFEDHTK 358
           +   G    T R   D+ +
Sbjct: 101 NAQKGFCMSTLRTHRDYVQ 119


>BT030455-1|ABP87897.1| 1108|Drosophila melanogaster RE64336p protein.
          Length = 1108

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 3/108 (2%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T  GH   +  ++ +  Y   ILSSS DKT+ +W ++R E          + H  F++ +
Sbjct: 792  TYNGHTSDLLDVSWSKNY--FILSSSMDKTVRLWHISRKE------CLCCFQHIDFVTAI 843

Query: 248  VL-SSDGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC 382
                 D  Y LSGS D  LRLW++   K       +  TK+   + FC
Sbjct: 844  AFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC 891


>BT024267-1|ABC86329.1|  604|Drosophila melanogaster IP15590p
           protein.
          Length = 604

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +LR TL GH+G V   A   + P  +++ S D+TL +W L     +    + +  G S  
Sbjct: 395 RLRHTLTGHSGKV-MAAKYVQEPIKVVTGSHDRTLKIWDL----RSIACIETKFAGSS-- 447

Query: 236 ISDVVLSSD-GNYALSGSWDKTLRLWDLAAGK 328
            +D+V +   G+  +SG +DK +R WD+   K
Sbjct: 448 CNDLVTTDSLGSTIISGHYDKKIRFWDIRTEK 479


>AY075401-1|AAL68231.1| 1326|Drosophila melanogaster LD30271p protein.
          Length = 1326

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 46/95 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH+  V  I       + I+S S D TL VW         G   + L GH+  +    
Sbjct: 990  LKGHDDHV--ITCLQFSGNRIVSGSDDNTLKVWSAVN-----GKCLRTLVGHTGGVWSSQ 1042

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +S  GN  +SGS D+TL++WD+ +G      + HT
Sbjct: 1043 MS--GNIIISGSTDRTLKVWDMDSGACVHTLQGHT 1075



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +2

Query: 68   TLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            TL GH G  W +Q++ N     +I+S S D+TL VW +     + G     L GH+  + 
Sbjct: 1030 TLVGHTGGVWSSQMSGN-----IIISGSTDRTLKVWDM-----DSGACVHTLQGHTSTVR 1079

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             + L   G+  +SGS D TLR+WD+  G
Sbjct: 1080 CMHLH--GSKVVSGSRDATLRVWDIEQG 1105



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 21/75 (28%), Positives = 36/75 (48%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            +I+S + D  + +W   R E  +      L GH++ +    L  DG + +SGS D ++R+
Sbjct: 1127 LIVSGAYDYMVKIWHPERQECLH-----TLQGHTNRVYS--LQFDGLHVVSGSLDTSIRV 1179

Query: 308  WDLAAGKTTRRFEDH 352
            WD+  G        H
Sbjct: 1180 WDVETGNCKHTLMGH 1194



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 26/96 (27%), Positives = 42/96 (43%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH   V  +     +   ++S SRD TL VW + +     G     L GH   +  V
Sbjct: 1070 TLQGHTSTVRCMHL---HGSKVVSGSRDATLRVWDIEQ-----GSCLHVLVGHLAAVRCV 1121

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                DG   +SG++D  +++W     +     + HT
Sbjct: 1122 --QYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHT 1155


>AY061300-1|AAL28848.1| 1326|Drosophila melanogaster LD21322p protein.
          Length = 1326

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 46/95 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH+  V  I       + I+S S D TL VW         G   + L GH+  +    
Sbjct: 990  LKGHDDHV--ITCLQFSGNRIVSGSDDNTLKVWSAVN-----GKCLRTLVGHTGGVWSSQ 1042

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +S  GN  +SGS D+TL++WD+ +G      + HT
Sbjct: 1043 MS--GNIIISGSTDRTLKVWDMDSGACVHTLQGHT 1075



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +2

Query: 68   TLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            TL GH G  W +Q++ N     +I+S S D+TL VW +     + G     L GH+  + 
Sbjct: 1030 TLVGHTGGVWSSQMSGN-----IIISGSTDRTLKVWDM-----DSGACVHTLQGHTSTVR 1079

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             + L   G+  +SGS D TLR+WD+  G
Sbjct: 1080 CMHLH--GSKVVSGSRDATLRVWDIEQG 1105



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 21/75 (28%), Positives = 36/75 (48%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            +I+S + D  + +W   R E  +      L GH++ +    L  DG + +SGS D ++R+
Sbjct: 1127 LIVSGAYDYMVKIWHPERQECLH-----TLQGHTNRVYS--LQFDGLHVVSGSLDTSIRV 1179

Query: 308  WDLAAGKTTRRFEDH 352
            WD+  G        H
Sbjct: 1180 WDVETGNCKHTLMGH 1194



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 26/96 (27%), Positives = 42/96 (43%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH   V  +     +   ++S SRD TL VW + +     G     L GH   +  V
Sbjct: 1070 TLQGHTSTVRCMHL---HGSKVVSGSRDATLRVWDIEQ-----GSCLHVLVGHLAAVRCV 1121

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                DG   +SG++D  +++W     +     + HT
Sbjct: 1122 --QYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHT 1155


>AY058742-1|AAL13971.1|  419|Drosophila melanogaster LP08352p
           protein.
          Length = 419

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +LR TL GH+G V   A   + P  +++ S D+TL +W L     +    + +  G S  
Sbjct: 210 RLRHTLTGHSGKV-MAAKYVQEPIKVVTGSHDRTLKIWDL----RSIACIETKFAGSS-- 262

Query: 236 ISDVVLSSD-GNYALSGSWDKTLRLWDLAAGK 328
            +D+V +   G+  +SG +DK +R WD+   K
Sbjct: 263 CNDLVTTDSLGSTIISGHYDKKIRFWDIRTEK 294


>AY051546-1|AAK92970.1|  888|Drosophila melanogaster GH19431p
           protein.
          Length = 888

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 3/108 (2%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   +  ++ +  Y   ILSSS DKT+ +W ++R E          + H  F++ +
Sbjct: 572 TYNGHTSDLLDVSWSKNY--FILSSSMDKTVRLWHISRKE------CLCCFQHIDFVTAI 623

Query: 248 VL-SSDGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC 382
                D  Y LSGS D  LRLW++   K       +  TK+   + FC
Sbjct: 624 AFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC 671


>AE014297-4471|ABI31217.1| 1078|Drosophila melanogaster CG34133-PB,
            isoform B protein.
          Length = 1078

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 3/108 (2%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T  GH   +  ++ +  Y   ILSSS DKT+ +W ++R E          + H  F++ +
Sbjct: 762  TYNGHTSDLLDVSWSKNY--FILSSSMDKTVRLWHISRKE------CLCCFQHIDFVTAI 813

Query: 248  VL-SSDGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC 382
                 D  Y LSGS D  LRLW++   K       +  TK+   + FC
Sbjct: 814  AFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC 861


>AE014297-4470|AAN14200.2| 1112|Drosophila melanogaster CG34133-PA,
            isoform A protein.
          Length = 1112

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 3/108 (2%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            T  GH   +  ++ +  Y   ILSSS DKT+ +W ++R E          + H  F++ +
Sbjct: 796  TYNGHTSDLLDVSWSKNY--FILSSSMDKTVRLWHISRKE------CLCCFQHIDFVTAI 847

Query: 248  VL-SSDGNYALSGSWDKTLRLWDLAAGKTT--RRFEDHTKV*QNS*FC 382
                 D  Y LSGS D  LRLW++   K       +  TK+   + FC
Sbjct: 848  AFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFC 895


>AE014297-4455|AAF56951.3|  419|Drosophila melanogaster CG31033-PA,
           isoform A protein.
          Length = 419

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +LR TL GH+G V   A   + P  +++ S D+TL +W L     +    + +  G S  
Sbjct: 210 RLRHTLTGHSGKV-MAAKYVQEPIKVVTGSHDRTLKIWDL----RSIACIETKFAGSS-- 262

Query: 236 ISDVVLSSD-GNYALSGSWDKTLRLWDLAAGK 328
            +D+V +   G+  +SG +DK +R WD+   K
Sbjct: 263 CNDLVTTDSLGSTIISGHYDKKIRFWDIRTEK 294


>AE014297-4454|AAF56950.3|  445|Drosophila melanogaster CG31033-PB,
           isoform B protein.
          Length = 445

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +LR TL GH+G V   A   + P  +++ S D+TL +W L     +    + +  G S  
Sbjct: 236 RLRHTLTGHSGKV-MAAKYVQEPIKVVTGSHDRTLKIWDL----RSIACIETKFAGSS-- 288

Query: 236 ISDVVLSSD-GNYALSGSWDKTLRLWDLAAGK 328
            +D+V +   G+  +SG +DK +R WD+   K
Sbjct: 289 CNDLVTTDSLGSTIISGHYDKKIRFWDIRTEK 320


>AE014297-4453|AAF56952.3|  604|Drosophila melanogaster CG31033-PC,
           isoform C protein.
          Length = 604

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 29/92 (31%), Positives = 48/92 (52%), Gaps = 1/92 (1%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +LR TL GH+G V   A   + P  +++ S D+TL +W L     +    + +  G S  
Sbjct: 395 RLRHTLTGHSGKV-MAAKYVQEPIKVVTGSHDRTLKIWDL----RSIACIETKFAGSS-- 447

Query: 236 ISDVVLSSD-GNYALSGSWDKTLRLWDLAAGK 328
            +D+V +   G+  +SG +DK +R WD+   K
Sbjct: 448 CNDLVTTDSLGSTIISGHYDKKIRFWDIRTEK 479


>AE014296-806|AAG22246.1| 1326|Drosophila melanogaster CG15010-PC,
            isoform C protein.
          Length = 1326

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 46/95 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH+  V  I       + I+S S D TL VW         G   + L GH+  +    
Sbjct: 990  LKGHDDHV--ITCLQFSGNRIVSGSDDNTLKVWSAVN-----GKCLRTLVGHTGGVWSSQ 1042

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +S  GN  +SGS D+TL++WD+ +G      + HT
Sbjct: 1043 MS--GNIIISGSTDRTLKVWDMDSGACVHTLQGHT 1075



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +2

Query: 68   TLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            TL GH G  W +Q++ N     +I+S S D+TL VW +     + G     L GH+  + 
Sbjct: 1030 TLVGHTGGVWSSQMSGN-----IIISGSTDRTLKVWDM-----DSGACVHTLQGHTSTVR 1079

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             + L   G+  +SGS D TLR+WD+  G
Sbjct: 1080 CMHLH--GSKVVSGSRDATLRVWDIEQG 1105



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 21/75 (28%), Positives = 36/75 (48%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            +I+S + D  + +W   R E  +      L GH++ +    L  DG + +SGS D ++R+
Sbjct: 1127 LIVSGAYDYMVKIWHPERQECLH-----TLQGHTNRVYS--LQFDGLHVVSGSLDTSIRV 1179

Query: 308  WDLAAGKTTRRFEDH 352
            WD+  G        H
Sbjct: 1180 WDVETGNCKHTLMGH 1194



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 26/96 (27%), Positives = 42/96 (43%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH   V  +     +   ++S SRD TL VW + +     G     L GH   +  V
Sbjct: 1070 TLQGHTSTVRCMHL---HGSKVVSGSRDATLRVWDIEQ-----GSCLHVLVGHLAAVRCV 1121

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                DG   +SG++D  +++W     +     + HT
Sbjct: 1122 --QYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHT 1155


>AE014296-805|AAG22247.1| 1326|Drosophila melanogaster CG15010-PB,
            isoform B protein.
          Length = 1326

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 46/95 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH+  V  I       + I+S S D TL VW         G   + L GH+  +    
Sbjct: 990  LKGHDDHV--ITCLQFSGNRIVSGSDDNTLKVWSAVN-----GKCLRTLVGHTGGVWSSQ 1042

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +S  GN  +SGS D+TL++WD+ +G      + HT
Sbjct: 1043 MS--GNIIISGSTDRTLKVWDMDSGACVHTLQGHT 1075



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +2

Query: 68   TLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            TL GH G  W +Q++ N     +I+S S D+TL VW +     + G     L GH+  + 
Sbjct: 1030 TLVGHTGGVWSSQMSGN-----IIISGSTDRTLKVWDM-----DSGACVHTLQGHTSTVR 1079

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             + L   G+  +SGS D TLR+WD+  G
Sbjct: 1080 CMHLH--GSKVVSGSRDATLRVWDIEQG 1105



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 21/75 (28%), Positives = 36/75 (48%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            +I+S + D  + +W   R E  +      L GH++ +    L  DG + +SGS D ++R+
Sbjct: 1127 LIVSGAYDYMVKIWHPERQECLH-----TLQGHTNRVYS--LQFDGLHVVSGSLDTSIRV 1179

Query: 308  WDLAAGKTTRRFEDH 352
            WD+  G        H
Sbjct: 1180 WDVETGNCKHTLMGH 1194



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 26/96 (27%), Positives = 42/96 (43%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH   V  +     +   ++S SRD TL VW + +     G     L GH   +  V
Sbjct: 1070 TLQGHTSTVRCMHL---HGSKVVSGSRDATLRVWDIEQ-----GSCLHVLVGHLAAVRCV 1121

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                DG   +SG++D  +++W     +     + HT
Sbjct: 1122 --QYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHT 1155


>AE014296-804|AAF47869.1| 1326|Drosophila melanogaster CG15010-PA,
            isoform A protein.
          Length = 1326

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 31/95 (32%), Positives = 46/95 (48%)
 Frame = +2

Query: 71   LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
            L+GH+  V  I       + I+S S D TL VW         G   + L GH+  +    
Sbjct: 990  LKGHDDHV--ITCLQFSGNRIVSGSDDNTLKVWSAVN-----GKCLRTLVGHTGGVWSSQ 1042

Query: 251  LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            +S  GN  +SGS D+TL++WD+ +G      + HT
Sbjct: 1043 MS--GNIIISGSTDRTLKVWDMDSGACVHTLQGHT 1075



 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +2

Query: 68   TLRGHNG--WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFIS 241
            TL GH G  W +Q++ N     +I+S S D+TL VW +     + G     L GH+  + 
Sbjct: 1030 TLVGHTGGVWSSQMSGN-----IIISGSTDRTLKVWDM-----DSGACVHTLQGHTSTVR 1079

Query: 242  DVVLSSDGNYALSGSWDKTLRLWDLAAG 325
             + L   G+  +SGS D TLR+WD+  G
Sbjct: 1080 CMHLH--GSKVVSGSRDATLRVWDIEQG 1105



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 21/75 (28%), Positives = 36/75 (48%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            +I+S + D  + +W   R E  +      L GH++ +    L  DG + +SGS D ++R+
Sbjct: 1127 LIVSGAYDYMVKIWHPERQECLH-----TLQGHTNRVYS--LQFDGLHVVSGSLDTSIRV 1179

Query: 308  WDLAAGKTTRRFEDH 352
            WD+  G        H
Sbjct: 1180 WDVETGNCKHTLMGH 1194



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 26/96 (27%), Positives = 42/96 (43%)
 Frame = +2

Query: 68   TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
            TL+GH   V  +     +   ++S SRD TL VW + +     G     L GH   +  V
Sbjct: 1070 TLQGHTSTVRCMHL---HGSKVVSGSRDATLRVWDIEQ-----GSCLHVLVGHLAAVRCV 1121

Query: 248  VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
                DG   +SG++D  +++W     +     + HT
Sbjct: 1122 --QYDGKLIVSGAYDYMVKIWHPERQECLHTLQGHT 1155


>AY113244-1|AAM29249.1|  308|Drosophila melanogaster AT12460p
           protein.
          Length = 308

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/73 (31%), Positives = 35/73 (47%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           LS   DK + +W         G+  K   GH+  ++D   S D +Y +S S DK++  WD
Sbjct: 33  LSCGSDKKIKLWNPAS-----GLLLKTYGGHADEVTDAAGSCDSSYIVSASLDKSIIYWD 87

Query: 314 LAAGKTTRRFEDH 352
           ++ G   RR   H
Sbjct: 88  VSTGAPVRRLRSH 100



 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 26/83 (31%), Positives = 41/83 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   VT  A +      I+S+S DK++I W ++      G P +RL  H+  +  V
Sbjct: 54  TYGGHADEVTDAAGSCD-SSYIVSASLDKSIIYWDVST-----GAPVRRLRSHAGGVRCV 107

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
             + D + A+SG  D  +  WD+
Sbjct: 108 CFNEDSSIAISGGRDNAVMCWDI 130



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           DG Y LS   DK ++LW+ A+G   + +  H
Sbjct: 28  DGTYCLSCGSDKKIKLWNPASGLLLKTYGGH 58


>AF132174-1|AAD34762.1|  331|Drosophila melanogaster unknown
           protein.
          Length = 331

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 27/100 (27%), Positives = 49/100 (49%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+  TL GH   V  +  +P    ++L++S D  + ++ +T  +         L GH+ +
Sbjct: 203 KVVQTLEGHAMPVRSLCFSPN-SQLLLTASDDGHMKLYDVTHSD-----VVGTLSGHASW 256

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  V  S DG +  S S D ++++WD +  K    F +HT
Sbjct: 257 VLCVAFSEDGKHFASSSSDNSVKIWDTSERKCLHTFAEHT 296



 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 24/67 (35%), Positives = 34/67 (50%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D +++   D  + VW L  D N   +  K L GH+  +  V +SSDG    S S D T+ 
Sbjct: 53  DFLVTGGLDDLVKVWDLQED-NTLKLRHK-LKGHALGVVSVAVSSDGQTIASSSLDSTMC 110

Query: 305 LWDLAAG 325
           LWD  +G
Sbjct: 111 LWDARSG 117



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +2

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  S DG Y  SG+ D  + ++D+AAGK  +  E H
Sbjct: 176 IAYSPDGKYIASGAIDGIITIFDVAAGKVVQTLEGH 211



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 29/114 (25%), Positives = 48/114 (42%), Gaps = 1/114 (0%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSE-TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           G   L K +    + TLKLR  L+GH   V  +A +      I SSS D T+ +W     
Sbjct: 59  GLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSD-GQTIASSSLDSTMCLWDARSG 117

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +  + +     +G    +  V  S    Y +SG  D  + ++ +  GK  +  +
Sbjct: 118 DKKHLLS----FGPVD-LWTVQFSPCNKYVISGLNDGKISMYSVETGKAEQTLD 166


>AE014297-1074|AAF54480.1|  331|Drosophila melanogaster CG3909-PA
           protein.
          Length = 331

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 27/100 (27%), Positives = 49/100 (49%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+  TL GH   V  +  +P    ++L++S D  + ++ +T  +         L GH+ +
Sbjct: 203 KVVQTLEGHAMPVRSLCFSPN-SQLLLTASDDGHMKLYDVTHSD-----VVGTLSGHASW 256

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           +  V  S DG +  S S D ++++WD +  K    F +HT
Sbjct: 257 VLCVAFSEDGKHFASSSSDNSVKIWDTSERKCLHTFAEHT 296



 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 24/67 (35%), Positives = 34/67 (50%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D +++   D  + VW L  D N   +  K L GH+  +  V +SSDG    S S D T+ 
Sbjct: 53  DFLVTGGLDDLVKVWDLQED-NTLKLRHK-LKGHALGVVSVAVSSDGQTIASSSLDSTMC 110

Query: 305 LWDLAAG 325
           LWD  +G
Sbjct: 111 LWDARSG 117



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 14/36 (38%), Positives = 21/36 (58%)
 Frame = +2

Query: 245 VVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  S DG Y  SG+ D  + ++D+AAGK  +  E H
Sbjct: 176 IAYSPDGKYIASGAIDGIITIFDVAAGKVVQTLEGH 211



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 29/114 (25%), Positives = 48/114 (42%), Gaps = 1/114 (0%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSE-TLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD 184
           G   L K +    + TLKLR  L+GH   V  +A +      I SSS D T+ +W     
Sbjct: 59  GLDDLVKVWDLQEDNTLKLRHKLKGHALGVVSVAVSSD-GQTIASSSLDSTMCLWDARSG 117

Query: 185 ENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           +  + +     +G    +  V  S    Y +SG  D  + ++ +  GK  +  +
Sbjct: 118 DKKHLLS----FGPVD-LWTVQFSPCNKYVISGLNDGKISMYSVETGKAEQTLD 166


>AE014134-2684|AAF53509.2|  308|Drosophila melanogaster CG4935-PA
           protein.
          Length = 308

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/73 (31%), Positives = 35/73 (47%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           LS   DK + +W         G+  K   GH+  ++D   S D +Y +S S DK++  WD
Sbjct: 33  LSCGSDKKIKLWNPAS-----GLLLKTYGGHADEVTDAAGSCDSSYIVSASLDKSIIYWD 87

Query: 314 LAAGKTTRRFEDH 352
           ++ G   RR   H
Sbjct: 88  VSTGAPVRRLRSH 100



 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 26/83 (31%), Positives = 41/83 (49%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T  GH   VT  A +      I+S+S DK++I W ++      G P +RL  H+  +  V
Sbjct: 54  TYGGHADEVTDAAGSCD-SSYIVSASLDKSIIYWDVST-----GAPVRRLRSHAGGVRCV 107

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
             + D + A+SG  D  +  WD+
Sbjct: 108 CFNEDSSIAISGGRDNAVMCWDI 130



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 12/31 (38%), Positives = 18/31 (58%)
 Frame = +2

Query: 260 DGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           DG Y LS   DK ++LW+ A+G   + +  H
Sbjct: 28  DGTYCLSCGSDKKIKLWNPASGLLLKTYGGH 58


>BT003755-1|AAO41419.1|  617|Drosophila melanogaster RE74146p
           protein.
          Length = 617

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 179 RDENNYGIPQKRLY-GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           RD   +   +  +Y GH+  +  V +   G Y +SGS DKT+++W++A G+  R  E
Sbjct: 263 RDLQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTIE 319



 Score = 29.5 bits (63), Expect = 3.9
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           RGH   V  ++  PK  + ++S S DKT+ +W++
Sbjct: 277 RGHTDLVRSVSVEPK-GEYLVSGSDDKTVKIWEI 309


>AY069513-1|AAL39658.1|  784|Drosophila melanogaster LD23326p
           protein.
          Length = 784

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 179 RDENNYGIPQKRLY-GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           RD   +   +  +Y GH+  +  V +   G Y +SGS DKT+++W++A G+  R  E
Sbjct: 430 RDLQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTIE 486



 Score = 29.5 bits (63), Expect = 3.9
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           RGH   V  ++  PK  + ++S S DKT+ +W++
Sbjct: 444 RGHTDLVRSVSVEPK-GEYLVSGSDDKTVKIWEI 476


>AL035311-5|CAA22953.1|  784|Drosophila melanogaster EG:52C10.1
           protein.
          Length = 784

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 179 RDENNYGIPQKRLY-GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           RD   +   +  +Y GH+  +  V +   G Y +SGS DKT+++W++A G+  R  E
Sbjct: 430 RDLQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTIE 486



 Score = 29.5 bits (63), Expect = 3.9
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           RGH   V  ++  PK  + ++S S DKT+ +W++
Sbjct: 444 RGHTDLVRSVSVEPK-GEYLVSGSDDKTVKIWEI 476


>AE013599-2568|AAM68487.1|  617|Drosophila melanogaster CG5033-PB,
           isoform B protein.
          Length = 617

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 179 RDENNYGIPQKRLY-GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           RD   +   +  +Y GH+  +  V +   G Y +SGS DKT+++W++A G+  R  E
Sbjct: 263 RDLQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTIE 319



 Score = 29.5 bits (63), Expect = 3.9
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           RGH   V  ++  PK  + ++S S DKT+ +W++
Sbjct: 277 RGHTDLVRSVSVEPK-GEYLVSGSDDKTVKIWEI 309


>AE013599-2567|AAF57786.1|  784|Drosophila melanogaster CG5033-PA,
           isoform A protein.
          Length = 784

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)
 Frame = +2

Query: 179 RDENNYGIPQKRLY-GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
           RD   +   +  +Y GH+  +  V +   G Y +SGS DKT+++W++A G+  R  E
Sbjct: 430 RDLQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIRTIE 486



 Score = 29.5 bits (63), Expect = 3.9
 Identities = 12/34 (35%), Positives = 21/34 (61%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           RGH   V  ++  PK  + ++S S DKT+ +W++
Sbjct: 444 RGHTDLVRSVSVEPK-GEYLVSGSDDKTVKIWEI 476


>AY094717-1|AAM11070.1|  487|Drosophila melanogaster GH17724p
           protein.
          Length = 487

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I++ S D+T I+W +       G+P + L GH H ++ V         ++ S D T R
Sbjct: 291 DQIITGSWDRTAILWDVET-----GLPLQPLTGHDHELTHVSAHPTQRLVVTASRDTTFR 345

Query: 305 LWDL-AAGKTTRRFEDHTKV*QNS*F 379
           LWD   A      F+ HT+   +S F
Sbjct: 346 LWDFREAIPAVSVFQGHTETVTSSVF 371



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 23/83 (27%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDV 247
           L GH+  +T ++ +P    +++++SRD T  +W          IP   ++ GH+  ++  
Sbjct: 316 LTGHDHELTHVSAHPTQR-LVVTASRDTTFRLWDFRE-----AIPAVSVFQGHTETVTSS 369

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
           V + D    +SGS D+T+++W+L
Sbjct: 370 VFARDDK-VVSGSDDRTIKVWEL 391



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 21/81 (25%), Positives = 38/81 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   + Q+A     P +I ++S D T  +W +   E+   + Q +  GH+  ++ +   
Sbjct: 158 GHKDGIWQVAAKAGQP-IIGTASADHTACIWGV---ESARCLLQYQ--GHAGSVNSIKFH 211

Query: 257 SDGNYALSGSWDKTLRLWDLA 319
              +  L+GS D T  +W  A
Sbjct: 212 QQRDLVLTGSGDGTAHIWQAA 232



 Score = 29.5 bits (63), Expect = 3.9
 Identities = 13/44 (29%), Positives = 20/44 (45%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH   +      S  +  ++GSWD+T  LWD+  G   +    H
Sbjct: 276 GHLSVVVAADWLSSMDQIITGSWDRTAILWDVETGLPLQPLTGH 319


>AE014297-2520|AAF55555.1|  487|Drosophila melanogaster CG12333-PA
           protein.
          Length = 487

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           D I++ S D+T I+W +       G+P + L GH H ++ V         ++ S D T R
Sbjct: 291 DQIITGSWDRTAILWDVET-----GLPLQPLTGHDHELTHVSAHPTQRLVVTASRDTTFR 345

Query: 305 LWDL-AAGKTTRRFEDHTKV*QNS*F 379
           LWD   A      F+ HT+   +S F
Sbjct: 346 LWDFREAIPAVSVFQGHTETVTSSVF 371



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 23/83 (27%), Positives = 46/83 (55%), Gaps = 1/83 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDV 247
           L GH+  +T ++ +P    +++++SRD T  +W          IP   ++ GH+  ++  
Sbjct: 316 LTGHDHELTHVSAHPTQR-LVVTASRDTTFRLWDFRE-----AIPAVSVFQGHTETVTSS 369

Query: 248 VLSSDGNYALSGSWDKTLRLWDL 316
           V + D    +SGS D+T+++W+L
Sbjct: 370 VFARDDK-VVSGSDDRTIKVWEL 391



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 21/81 (25%), Positives = 38/81 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   + Q+A     P +I ++S D T  +W +   E+   + Q +  GH+  ++ +   
Sbjct: 158 GHKDGIWQVAAKAGQP-IIGTASADHTACIWGV---ESARCLLQYQ--GHAGSVNSIKFH 211

Query: 257 SDGNYALSGSWDKTLRLWDLA 319
              +  L+GS D T  +W  A
Sbjct: 212 QQRDLVLTGSGDGTAHIWQAA 232



 Score = 29.5 bits (63), Expect = 3.9
 Identities = 13/44 (29%), Positives = 20/44 (45%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH   +      S  +  ++GSWD+T  LWD+  G   +    H
Sbjct: 276 GHLSVVVAADWLSSMDQIITGSWDRTAILWDVETGLPLQPLTGH 319


>AY061623-1|AAL29171.1|  553|Drosophila melanogaster SD09427p
           protein.
          Length = 553

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 1/95 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V  +  +P     I + S+D T  +W L R +  Y IP      H++ ISDV 
Sbjct: 433 LEGHLGAVFGVDFSPN-GFHIATGSQDNTCKIWDLRRRQPVYTIP-----AHTNLISDVK 486

Query: 251 LSSD-GNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              + G++ ++ S+D T ++W     +  +  + H
Sbjct: 487 YQQECGSFLVTCSYDSTTKIWSNKTWQPLKTLQGH 521



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 30/108 (27%), Positives = 45/108 (41%), Gaps = 7/108 (6%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNP--KYPD----MILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +L+ TLRGH  +V  +A  P  K  +     + S   D  + +W    +E+   I     
Sbjct: 294 ELKQTLRGHASYVGGVALRPGVKADEENVVAMASGGHDGAVKLWGFNNEESIADIT---- 349

Query: 218 YGHS-HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            GH  H +S V     G +  +  +D + RLWDL         E H K
Sbjct: 350 -GHMPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQEGHAK 396



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 19/81 (23%), Positives = 37/81 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   ++ +    +    +++ S D T  +W      N    P K L GH + +  V
Sbjct: 474 TIPAHTNLISDVKYQQECGSFLVTCSYDSTTKIWS-----NKTWQPLKTLQGHDNKVISV 528

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            ++ +  Y  + S+D+T +LW
Sbjct: 529 DIAPNSQYIATTSFDRTFKLW 549



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH+  +  +   SDG+  ++G  D   R+WDL  G+     E H
Sbjct: 393 GHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGH 436



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           L GH   +  V  S +G +  +GS D T ++WDL   +       HT +
Sbjct: 433 LEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQPVYTIPAHTNL 481


>AE014296-2921|AAF49331.1|  553|Drosophila melanogaster CG6322-PA
           protein.
          Length = 553

 Score = 41.9 bits (94), Expect = 7e-04
 Identities = 27/95 (28%), Positives = 46/95 (48%), Gaps = 1/95 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G V  +  +P     I + S+D T  +W L R +  Y IP      H++ ISDV 
Sbjct: 433 LEGHLGAVFGVDFSPN-GFHIATGSQDNTCKIWDLRRRQPVYTIP-----AHTNLISDVK 486

Query: 251 LSSD-GNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
              + G++ ++ S+D T ++W     +  +  + H
Sbjct: 487 YQQECGSFLVTCSYDSTTKIWSNKTWQPLKTLQGH 521



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 30/108 (27%), Positives = 45/108 (41%), Gaps = 7/108 (6%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNP--KYPD----MILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +L+ TLRGH  +V  +A  P  K  +     + S   D  + +W    +E+   I     
Sbjct: 294 ELKQTLRGHASYVGGVALRPGVKADEENVVAMASGGHDGAVKLWGFNNEESIADIT---- 349

Query: 218 YGHS-HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            GH  H +S V     G +  +  +D + RLWDL         E H K
Sbjct: 350 -GHMPHRVSKVAFHPSGRFLATACYDSSWRLWDLEQKTEVLHQEGHAK 396



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 19/81 (23%), Positives = 37/81 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T+  H   ++ +    +    +++ S D T  +W      N    P K L GH + +  V
Sbjct: 474 TIPAHTNLISDVKYQQECGSFLVTCSYDSTTKIWS-----NKTWQPLKTLQGHDNKVISV 528

Query: 248 VLSSDGNYALSGSWDKTLRLW 310
            ++ +  Y  + S+D+T +LW
Sbjct: 529 DIAPNSQYIATTSFDRTFKLW 549



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 14/44 (31%), Positives = 22/44 (50%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           GH+  +  +   SDG+  ++G  D   R+WDL  G+     E H
Sbjct: 393 GHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGRCIMFLEGH 436



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 15/49 (30%), Positives = 23/49 (46%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           L GH   +  V  S +G +  +GS D T ++WDL   +       HT +
Sbjct: 433 LEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQPVYTIPAHTNL 481


>BT004841-1|AAO45197.1|  358|Drosophila melanogaster RH17413p
           protein.
          Length = 358

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 28/110 (25%), Positives = 48/110 (43%), Gaps = 2/110 (1%)
 Frame = +2

Query: 29  PFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           P +   E    + T+  H  +++     P     IL+ S D T  +W +       G   
Sbjct: 140 PITSDEEMAAKKRTVGTHTSYMS-CCIYPNSDQQILTGSGDSTCALWDVES-----GQLL 193

Query: 209 KRLYGHSHFIS--DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  +GHS  +   D+  +  GN  +SGS D+   +WD+ +G   + FE H
Sbjct: 194 QSFHGHSGDVMAIDLAPNETGNTFVSGSCDRMAFIWDMRSGHVVQSFEGH 243



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 16/32 (50%), Positives = 22/32 (68%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           LYGH + +S V +S DG    +GSWD T+R+W
Sbjct: 326 LYGHENKVSCVQVSPDGTALSTGSWDYTIRVW 357



 Score = 31.9 bits (69), Expect = 0.73
 Identities = 25/100 (25%), Positives = 43/100 (43%), Gaps = 1/100 (1%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYP-DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           E+ +L  +  GH+G V  I   P    +  +S S D+   +W +       G   +   G
Sbjct: 188 ESGQLLQSFHGHSGDVMAIDLAPNETGNTFVSGSCDRMAFIWDMRS-----GHVVQSFEG 242

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           H   ++ V     G+   +GS D + RL+D+ A +    F
Sbjct: 243 HQSDVNSVKFHPCGDAIATGSDDSSCRLYDMRADREVAVF 282


>AF223065-1|AAF34688.1|  823|Drosophila melanogaster putative
           microtubule severingprotein katanin p80 subunit protein.
          Length = 823

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 27/96 (28%), Positives = 45/96 (46%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           K+  TL GH      +  NP   + ++S S D T+ +W + ++ENN     K   GH   
Sbjct: 93  KIYSTLNGHMKSGRTLDFNPS-GEYVVSGSNDTTVRLWDV-QNENNC---IKVCRGHMSH 147

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++ V  S DG +  S   + ++ +WD+   K    F
Sbjct: 148 VNSVKFSPDGLWIASAGLEGSILIWDIRKSKQIMEF 183



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIV-WKLTRDENNYGIPQKRLYGHSHFISD 244
           +L GHN  +  +     Y D  + S+ D  +I  W L    N+  I    L GH      
Sbjct: 55  SLTGHNRSIDCVRF--AYKDNFVYSADDIGIIRRWDL----NSQKI-YSTLNGHMKSGRT 107

Query: 245 VVLSSDGNYALSGSWDKTLRLWDL 316
           +  +  G Y +SGS D T+RLWD+
Sbjct: 108 LDFNPSGEYVVSGSNDTTVRLWDV 131


>AE014298-1137|AAF46336.1|  358|Drosophila melanogaster CG10763-PA
           protein.
          Length = 358

 Score = 41.5 bits (93), Expect = 0.001
 Identities = 28/110 (25%), Positives = 48/110 (43%), Gaps = 2/110 (1%)
 Frame = +2

Query: 29  PFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           P +   E    + T+  H  +++     P     IL+ S D T  +W +       G   
Sbjct: 140 PITSDEEMAAKKRTVGTHTSYMS-CCIYPNSDQQILTGSGDSTCALWDVES-----GQLL 193

Query: 209 KRLYGHSHFIS--DVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           +  +GHS  +   D+  +  GN  +SGS D+   +WD+ +G   + FE H
Sbjct: 194 QSFHGHSGDVMAIDLAPNETGNTFVSGSCDRMAFIWDMRSGHVVQSFEGH 243



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 16/32 (50%), Positives = 22/32 (68%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           LYGH + +S V +S DG    +GSWD T+R+W
Sbjct: 326 LYGHENKVSCVQVSPDGTALSTGSWDYTIRVW 357



 Score = 31.9 bits (69), Expect = 0.73
 Identities = 25/100 (25%), Positives = 43/100 (43%), Gaps = 1/100 (1%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYP-DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           E+ +L  +  GH+G V  I   P    +  +S S D+   +W +       G   +   G
Sbjct: 188 ESGQLLQSFHGHSGDVMAIDLAPNETGNTFVSGSCDRMAFIWDMRS-----GHVVQSFEG 242

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           H   ++ V     G+   +GS D + RL+D+ A +    F
Sbjct: 243 HQSDVNSVKFHPCGDAIATGSDDSSCRLYDMRADREVAVF 282


>BT023859-1|AAZ86780.1|  316|Drosophila melanogaster IP09508p
           protein.
          Length = 316

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 1/86 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H   V  +  NPK   ++     ++  L ++ + + E     P     GHS  + DV+  
Sbjct: 92  HTKTVACVDLNPKATRLLTGCIDQESPLALFDMEQSEK---APLMEFRGHSRGVRDVIFC 148

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTT 334
            + +  LS S+D+T+R+WD   G  T
Sbjct: 149 LEEHCFLSSSYDRTVRMWDCRTGTRT 174


>BT004480-1|AAO42644.1|  787|Drosophila melanogaster LD47550p
           protein.
          Length = 787

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 25/104 (24%), Positives = 50/104 (48%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           ++E+  L+G LRGH   V  +  +P    ++L+SS D TL +W +    +N+   ++  +
Sbjct: 506 LAESNTLQGVLRGHTRGVWSVRFSP-VDQIVLTSSSDCTLRIWSI----SNFSCIKR--F 558

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                I        G + +S + D  L+LW++      +  ++H
Sbjct: 559 DQECTILRAEFLDHGKFIISAASDGLLKLWNIKTNTCLQSLDEH 602



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 30/106 (28%), Positives = 47/106 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S +  LR     H+  V  +A  P    +I ++S+DKT  VW L       G+    L G
Sbjct: 465 SYSFNLRYAALSHDKEVNCVAYAPNNK-LIATASQDKTAKVW-LAESNTLQGV----LRG 518

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           H+  +  V  S      L+ S D TLR+W ++     +RF+    +
Sbjct: 519 HTRGVWSVRFSPVDQIVLTSSSDCTLRIWSISNFSCIKRFDQECTI 564



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDM--ILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           ET  L   +RGH   VT ++      D   I++ SRDK +IVW+L     +  +    LY
Sbjct: 194 ETKTLVHKMRGHLSQVTGLSFKSNASDCNEIVTVSRDKVMIVWQLQEQLESKQLKVLPLY 253

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
                +  VV + +G   +  S    L+  D
Sbjct: 254 DE---LEGVVYADEGQLIIVASGSGKLQQVD 281


>AE013599-943|AAF58888.1|  787|Drosophila melanogaster CG1671-PA
           protein.
          Length = 787

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 25/104 (24%), Positives = 50/104 (48%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           ++E+  L+G LRGH   V  +  +P    ++L+SS D TL +W +    +N+   ++  +
Sbjct: 506 LAESNTLQGVLRGHTRGVWSVRFSP-VDQIVLTSSSDCTLRIWSI----SNFSCIKR--F 558

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                I        G + +S + D  L+LW++      +  ++H
Sbjct: 559 DQECTILRAEFLDHGKFIISAASDGLLKLWNIKTNTCLQSLDEH 602



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 30/106 (28%), Positives = 47/106 (44%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S +  LR     H+  V  +A  P    +I ++S+DKT  VW L       G+    L G
Sbjct: 465 SYSFNLRYAALSHDKEVNCVAYAPNNK-LIATASQDKTAKVW-LAESNTLQGV----LRG 518

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
           H+  +  V  S      L+ S D TLR+W ++     +RF+    +
Sbjct: 519 HTRGVWSVRFSPVDQIVLTSSSDCTLRIWSISNFSCIKRFDQECTI 564



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDM--ILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           ET  L   +RGH   VT ++      D   I++ SRDK +IVW+L     +  +    LY
Sbjct: 194 ETKTLVHKMRGHLSQVTGLSFKSNASDCNEIVTVSRDKVMIVWQLQEQLESKQLKVLPLY 253

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
                +  VV + +G   +  S    L+  D
Sbjct: 254 DE---LEGVVYADEGQLIIVASGSGKLQQVD 281


>AE013599-911|AAF58908.2|  322|Drosophila melanogaster CG10459-PA
           protein.
          Length = 322

 Score = 40.7 bits (91), Expect = 0.002
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 1/86 (1%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           H   V  +  NPK   ++     ++  L ++ + + E     P     GHS  + DV+  
Sbjct: 98  HTKTVACVDLNPKATRLLTGCIDQESPLALFDMEQSEK---APLMEFRGHSRGVRDVIFC 154

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTT 334
            + +  LS S+D+T+R+WD   G  T
Sbjct: 155 LEEHCFLSSSYDRTVRMWDCRTGTRT 180


>Y14162-1|CAA74575.1|  478|Drosophila melanogaster fizzy-related
           protein protein.
          Length = 478

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 1/95 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-QKRLYGHSHFISDV 247
           L GH+  V  +A N    D++ S SRD+    W + RD     +  ++RL GH   +  +
Sbjct: 252 LNGHSARVGALAWNS---DILSSGSRDR----WIIQRDTRTPQLQSERRLAGHRQEVCGL 304

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S D  Y  SG  D  L +W+  +    + + +H
Sbjct: 305 KWSPDNQYLASGGNDNRLYVWNQHSVNPVQSYTEH 339



 Score = 35.1 bits (77), Expect = 0.078
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +L GHS+ +  + LS DG   ++G+ D+TLR W++
Sbjct: 423 KLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNV 457


>BT010011-1|AAQ22480.1|  478|Drosophila melanogaster RE20929p
           protein.
          Length = 478

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 1/95 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-QKRLYGHSHFISDV 247
           L GH+  V  +A N    D++ S SRD+    W + RD     +  ++RL GH   +  +
Sbjct: 252 LNGHSARVGALAWNS---DILSSGSRDR----WIIQRDTRTPQLQSERRLAGHRQEVCGL 304

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S D  Y  SG  D  L +W+  +    + + +H
Sbjct: 305 KWSPDNQYLASGGNDNRLYVWNQHSVNPVQSYTEH 339



 Score = 35.1 bits (77), Expect = 0.078
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +L GHS+ +  + LS DG   ++G+ D+TLR W++
Sbjct: 423 KLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNV 457


>BT001403-1|AAN71158.1|  478|Drosophila melanogaster GH07620p
           protein.
          Length = 478

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 1/95 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-QKRLYGHSHFISDV 247
           L GH+  V  +A N    D++ S SRD+    W + RD     +  ++RL GH   +  +
Sbjct: 252 LNGHSARVGALAWNS---DILSSGSRDR----WIIQRDTRTPQLQSERRLAGHRQEVCGL 304

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S D  Y  SG  D  L +W+  +    + + +H
Sbjct: 305 KWSPDNQYLASGGNDNRLYVWNQHSVNPVQSYTEH 339



 Score = 35.1 bits (77), Expect = 0.078
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +L GHS+ +  + LS DG   ++G+ D+TLR W++
Sbjct: 423 KLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNV 457


>AY118904-1|AAM50764.1|  743|Drosophila melanogaster LD16387p
           protein.
          Length = 743

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 1/93 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDVV 250
           R HN  +  +  +P     +++ S+D +  +W L ++          +Y GH+  +  V 
Sbjct: 536 RSHNYPIWCLDESP-VGQYVVTGSKDLSARLWSLEKEHALI------IYAGHTQDVECVA 588

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
              +GNY  +GS D ++RLW   +GK  R F D
Sbjct: 589 FHPNGNYIATGSADHSVRLWCATSGKLMRVFAD 621



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDV 247
           LRGH   VT +  +  YP ++ S S+D T+  W+       + +    +Y  H++ I  +
Sbjct: 493 LRGHTKGVTDVRFSAHYP-LMYSVSKDATMRCWRA------HNLHCAAIYRSHNYPIWCL 545

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S  G Y ++GS D + RLW L        +  HT+
Sbjct: 546 DESPVGQYVVTGSKDLSARLWSLEKEHALIIYAGHTQ 582



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 22/93 (23%), Positives = 40/93 (43%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +A +P   + I + S D ++ +W  T      G   +        ++ +  S
Sbjct: 579 GHTQDVECVAFHPN-GNYIATGSADHSVRLWCATS-----GKLMRVFADCRQAVTQLAFS 632

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DG    +   +  +R++DLAAG      +DH+
Sbjct: 633 PDGKMLAAAGEETKVRIFDLAAGAQLAELKDHS 665



 Score = 28.7 bits (61), Expect = 6.8
 Identities = 21/75 (28%), Positives = 35/75 (46%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           VTQ+A +P    M+ ++  +  + ++ L       G     L  HS  IS +  S+   +
Sbjct: 626 VTQLAFSPD-GKMLAAAGEETKVRIFDLAA-----GAQLAELKDHSASISSLSWSTHNRH 679

Query: 272 ALSGSWDKTLRLWDL 316
             +   D TLRLWD+
Sbjct: 680 LATACSDGTLRLWDI 694


>AE014298-661|AAN09125.1|  478|Drosophila melanogaster CG3000-PB,
           isoform B protein.
          Length = 478

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 1/95 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-QKRLYGHSHFISDV 247
           L GH+  V  +A N    D++ S SRD+    W + RD     +  ++RL GH   +  +
Sbjct: 252 LNGHSARVGALAWNS---DILSSGSRDR----WIIQRDTRTPQLQSERRLAGHRQEVCGL 304

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S D  Y  SG  D  L +W+  +    + + +H
Sbjct: 305 KWSPDNQYLASGGNDNRLYVWNQHSVNPVQSYTEH 339



 Score = 35.1 bits (77), Expect = 0.078
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +L GHS+ +  + LS DG   ++G+ D+TLR W++
Sbjct: 423 KLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNV 457


>AE014298-660|AAF45973.1|  478|Drosophila melanogaster CG3000-PA,
           isoform A protein.
          Length = 478

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 27/95 (28%), Positives = 44/95 (46%), Gaps = 1/95 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP-QKRLYGHSHFISDV 247
           L GH+  V  +A N    D++ S SRD+    W + RD     +  ++RL GH   +  +
Sbjct: 252 LNGHSARVGALAWNS---DILSSGSRDR----WIIQRDTRTPQLQSERRLAGHRQEVCGL 304

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
             S D  Y  SG  D  L +W+  +    + + +H
Sbjct: 305 KWSPDNQYLASGGNDNRLYVWNQHSVNPVQSYTEH 339



 Score = 35.1 bits (77), Expect = 0.078
 Identities = 14/35 (40%), Positives = 24/35 (68%)
 Frame = +2

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           +L GHS+ +  + LS DG   ++G+ D+TLR W++
Sbjct: 423 KLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNV 457


>AE014297-3302|AAF56118.1|  743|Drosophila melanogaster CG4448-PA
           protein.
          Length = 743

 Score = 40.3 bits (90), Expect = 0.002
 Identities = 26/93 (27%), Positives = 45/93 (48%), Gaps = 1/93 (1%)
 Frame = +2

Query: 74  RGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDVV 250
           R HN  +  +  +P     +++ S+D +  +W L ++          +Y GH+  +  V 
Sbjct: 536 RSHNYPIWCLDESP-VGQYVVTGSKDLSARLWSLEKEHALI------IYAGHTQDVECVA 588

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFED 349
              +GNY  +GS D ++RLW   +GK  R F D
Sbjct: 589 FHPNGNYIATGSADHSVRLWCATSGKLMRVFAD 621



 Score = 39.1 bits (87), Expect = 0.005
 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDV 247
           LRGH   VT +  +  YP ++ S S+D T+  W+       + +    +Y  H++ I  +
Sbjct: 493 LRGHTKGVTDVRFSAHYP-LMYSVSKDATMRCWRA------HNLHCAAIYRSHNYPIWCL 545

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S  G Y ++GS D + RLW L        +  HT+
Sbjct: 546 DESPVGQYVVTGSKDLSARLWSLEKEHALIIYAGHTQ 582



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 22/93 (23%), Positives = 40/93 (43%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   V  +A +P   + I + S D ++ +W  T      G   +        ++ +  S
Sbjct: 579 GHTQDVECVAFHPN-GNYIATGSADHSVRLWCATS-----GKLMRVFADCRQAVTQLAFS 632

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            DG    +   +  +R++DLAAG      +DH+
Sbjct: 633 PDGKMLAAAGEETKVRIFDLAAGAQLAELKDHS 665



 Score = 28.7 bits (61), Expect = 6.8
 Identities = 21/75 (28%), Positives = 35/75 (46%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           VTQ+A +P    M+ ++  +  + ++ L       G     L  HS  IS +  S+   +
Sbjct: 626 VTQLAFSPD-GKMLAAAGEETKVRIFDLAA-----GAQLAELKDHSASISSLSWSTHNRH 679

Query: 272 ALSGSWDKTLRLWDL 316
             +   D TLRLWD+
Sbjct: 680 LATACSDGTLRLWDI 694


>AE014134-985|AAF52302.4| 3489|Drosophila melanogaster CG14001-PA
            protein.
          Length = 3489

 Score = 39.9 bits (89), Expect = 0.003
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 2/97 (2%)
 Frame = +2

Query: 32   FSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK 211
            F    ++L ++ +L GH   VT +A +  Y ++I+S SRD T IVW +TR         +
Sbjct: 3055 FDANRKSLAVKHSLHGHTDAVTCLAASAAY-NVIVSGSRDGTAIVWDMTRFTF-----VR 3108

Query: 212  RLYGHSHFISDVVLSS-DGNYA-LSGSWDKTLRLWDL 316
            +L GH+  ++ V ++   G+ A  S +W   L +W +
Sbjct: 3109 QLRGHAGVVAAVSINELTGDIATCSATW---LHVWSI 3142



 Score = 39.5 bits (88), Expect = 0.004
 Identities = 19/78 (24%), Positives = 37/78 (47%)
 Frame = +2

Query: 128  MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
            MI+++     + +WK   +  +  +    L+GH+  ++ +  S+  N  +SGS D T  +
Sbjct: 3040 MIVTAGTSSVVTIWKFDANRKSLAVKHS-LHGHTDAVTCLAASAAYNVIVSGSRDGTAIV 3098

Query: 308  WDLAAGKTTRRFEDHTKV 361
            WD+      R+   H  V
Sbjct: 3099 WDMTRFTFVRQLRGHAGV 3116


>U62388-1|AAB37257.1|  430|Drosophila melanogaster chromatin
           assembly factor 1 p55subunit protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AY061408-1|AAL28956.1|  430|Drosophila melanogaster LD33761p
           protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294403-1|CAL26342.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294402-1|CAL26341.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294401-1|CAL26340.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294400-1|CAL26339.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294399-1|CAL26338.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294398-1|CAL26337.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294397-1|CAL26335.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294396-1|CAL26330.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294395-1|CAL26325.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294394-1|CAL26324.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294393-1|CAL26323.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AM294392-1|CAL26322.1|  430|Drosophila melanogaster CG4236 protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AF146345-1|AAD35017.1|  700|Drosophila melanogaster Ebi protein.
          Length = 700

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 33/106 (31%), Positives = 45/106 (42%), Gaps = 9/106 (8%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH   V  I   P+   ++ S S D TL +W + RD   +      L  HS  I  +
Sbjct: 529 TFKGHTNEVNAIKWCPQ-GQLLASCSDDMTLKIWSMNRDRCCHD-----LQAHSKEIYTI 582

Query: 248 VLSSDG--------NYAL-SGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S  G        N  L S S+D T+RLWD+  G        HT+
Sbjct: 583 KWSPTGPGTNNPNTNLILASASFDSTVRLWDVERGSCIHTLTKHTE 628



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 22/79 (27%), Positives = 37/79 (46%)
 Frame = +2

Query: 110 NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW 289
           NP    ++ S+S D T+ +W + R     G     L  H+  +  V  S DG +  SGS+
Sbjct: 593 NPNTNLILASASFDSTVRLWDVER-----GSCIHTLTKHTEPVYSVAFSPDGKHLASGSF 647

Query: 290 DKTLRLWDLAAGKTTRRFE 346
           DK + +W    G+    ++
Sbjct: 648 DKCVHIWSTQTGQLVHSYK 666



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GNY LS   DKT  +WD + G+ T++F  H+
Sbjct: 463 GNYILSAGVDKTTIIWDASTGQCTQQFAFHS 493



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 28/100 (28%), Positives = 47/100 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TL  H G +  +  N K  + ILS+  DKT I+W     + + G   ++   HS  
Sbjct: 442 RLASTLGQHKGPIFALKWN-KCGNYILSAGVDKTTIIW-----DASTGQCTQQFAFHSAP 495

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             DV   ++  +A S S D+ + +  L   +  + F+ HT
Sbjct: 496 ALDVDWQTNQAFA-SCSTDQRIHVCRLGVNEPIKTFKGHT 534



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 8/88 (9%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT---RDENNYGIPQKRLYGHSHFIS 241
           LRGH   V   A NP   D++ S S D T  +W ++    + N   +      G +   S
Sbjct: 351 LRGHESEVFICAWNPSR-DLLASGSGDSTARIWDMSDANTNSNQLVLRHCIQKGGAEVPS 409

Query: 242 DVVLSS-----DGNYALSGSWDKTLRLW 310
           +  ++S     DG+   +GS+D   R+W
Sbjct: 410 NKDVTSLDWNCDGSLLATGSYDGYARIW 437



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 19/74 (25%), Positives = 34/74 (45%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S S D+ + V +L  +E     P K   GH++ ++ +     G    S S D TL++W +
Sbjct: 509 SCSTDQRIHVCRLGVNE-----PIKTFKGHTNEVNAIKWCPQGQLLASCSDDMTLKIWSM 563

Query: 317 AAGKTTRRFEDHTK 358
              +     + H+K
Sbjct: 564 NRDRCCHDLQAHSK 577



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 3/52 (5%)
 Frame = +2

Query: 185 ENNYGIPQKR---LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           + N  IP+ +   L GH   +     +   +   SGS D T R+WD++   T
Sbjct: 338 DENIEIPESKARVLRGHESEVFICAWNPSRDLLASGSGDSTARIWDMSDANT 389


>AE014297-1961|AAF55146.1|  430|Drosophila melanogaster CG4236-PA
           protein.
          Length = 430

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)
 Frame = +2

Query: 38  KMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           K    +  +    GH   V  +A +  +  +  S + D+ L++W  TR+ NN   P   +
Sbjct: 216 KEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWD-TRN-NNTSKPSHTV 273

Query: 218 YGHSHFISDVVLSSDGNYAL-SGSWDKTLRLWDLAAGK-TTRRFEDH 352
             H+  ++ +  +    + L +GS DKT+ LWDL   K     FE H
Sbjct: 274 DAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESH 320



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 4/93 (4%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYG-IPQKRLY-GHSHFISD 244
           LRGH      ++ NP     +LS+S D T+ +W +      +  I  K ++ GH+  + D
Sbjct: 177 LRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINATPKEHRVIDAKNIFTGHTAVVED 236

Query: 245 VV--LSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           V   L  +  +  S + D+ L +WD     T++
Sbjct: 237 VAWHLLHESLFG-SVADDQKLMIWDTRNNNTSK 268



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 28/97 (28%), Positives = 44/97 (45%), Gaps = 2/97 (2%)
 Frame = +2

Query: 35  SKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSS-SRDKTLIVWKLTRDENNYGIPQK 211
           ++ + T K   T+  H   V  ++ NP Y + IL++ S DKT+ +W    D  N  +   
Sbjct: 261 TRNNNTSKPSHTVDAHTAEVNCLSFNP-YSEFILATGSADKTVALW----DLRNLKLKLH 315

Query: 212 RLYGHSHFISDVVLSSDGNYALSGS-WDKTLRLWDLA 319
               H   I  V  S      L+ S  D+ L +WDL+
Sbjct: 316 SFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLS 352



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/44 (29%), Positives = 22/44 (50%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQ 208
           GH   ++  + NP  P +I S S D  + VW++  +  N   P+
Sbjct: 376 GHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419


>AE014134-100|AAF51501.1|  700|Drosophila melanogaster CG4063-PA
           protein.
          Length = 700

 Score = 39.5 bits (88), Expect = 0.004
 Identities = 33/106 (31%), Positives = 45/106 (42%), Gaps = 9/106 (8%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           T +GH   V  I   P+   ++ S S D TL +W + RD   +      L  HS  I  +
Sbjct: 529 TFKGHTNEVNAIKWCPQ-GQLLASCSDDMTLKIWSMNRDRCCHD-----LQAHSKEIYTI 582

Query: 248 VLSSDG--------NYAL-SGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             S  G        N  L S S+D T+RLWD+  G        HT+
Sbjct: 583 KWSPTGPGTNNPNTNLILASASFDSTVRLWDVERGSCIHTLTKHTE 628



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 22/79 (27%), Positives = 37/79 (46%)
 Frame = +2

Query: 110 NPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSW 289
           NP    ++ S+S D T+ +W + R     G     L  H+  +  V  S DG +  SGS+
Sbjct: 593 NPNTNLILASASFDSTVRLWDVER-----GSCIHTLTKHTEPVYSVAFSPDGKHLASGSF 647

Query: 290 DKTLRLWDLAAGKTTRRFE 346
           DK + +W    G+    ++
Sbjct: 648 DKCVHIWSTQTGQLVHSYK 666



 Score = 35.5 bits (78), Expect = 0.059
 Identities = 14/31 (45%), Positives = 20/31 (64%)
 Frame = +2

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
           GNY LS   DKT  +WD + G+ T++F  H+
Sbjct: 463 GNYILSAGVDKTTIIWDASTGQCTQQFAFHS 493



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 28/100 (28%), Positives = 47/100 (47%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHF 235
           +L  TL  H G +  +  N K  + ILS+  DKT I+W     + + G   ++   HS  
Sbjct: 442 RLASTLGQHKGPIFALKWN-KCGNYILSAGVDKTTIIW-----DASTGQCTQQFAFHSAP 495

Query: 236 ISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
             DV   ++  +A S S D+ + +  L   +  + F+ HT
Sbjct: 496 ALDVDWQTNQAFA-SCSTDQRIHVCRLGVNEPIKTFKGHT 534



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 8/88 (9%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLT---RDENNYGIPQKRLYGHSHFIS 241
           LRGH   V   A NP   D++ S S D T  +W ++    + N   +      G +   S
Sbjct: 351 LRGHESEVFICAWNPSR-DLLASGSGDSTARIWDMSDANTNSNQLVLRHCIQKGGAEVPS 409

Query: 242 DVVLSS-----DGNYALSGSWDKTLRLW 310
           +  ++S     DG+   +GS+D   R+W
Sbjct: 410 NKDVTSLDWNCDGSLLATGSYDGYARIW 437



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 19/74 (25%), Positives = 34/74 (45%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           S S D+ + V +L  +E     P K   GH++ ++ +     G    S S D TL++W +
Sbjct: 509 SCSTDQRIHVCRLGVNE-----PIKTFKGHTNEVNAIKWCPQGQLLASCSDDMTLKIWSM 563

Query: 317 AAGKTTRRFEDHTK 358
              +     + H+K
Sbjct: 564 NRDRCCHDLQAHSK 577



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 3/52 (5%)
 Frame = +2

Query: 185 ENNYGIPQKR---LYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           + N  IP+ +   L GH   +     +   +   SGS D T R+WD++   T
Sbjct: 338 DENIEIPESKARVLRGHESEVFICAWNPSRDLLASGSGDSTARIWDMSDANT 389


>AY058773-1|AAL14002.1|  787|Drosophila melanogaster SD05646p
           protein.
          Length = 787

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPD---MILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +  KL   L GH+  V  +A  P  P+    ILS SRDK+  VWK      N  +    L
Sbjct: 6   DNYKLSCELLGHSMDVRAVAVGPPTPEGRQTILSGSRDKSTKVWK---PHGNEYLESLTL 62

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
             H +FIS +       +  + S D T+ ++
Sbjct: 63  QDHKNFISYICFLESERWICTASNDATICIY 93



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 22/84 (26%), Positives = 42/84 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+ H  +++ I         I ++S D T+ ++K    ++ + +P   L GH   +  +
Sbjct: 61  TLQDHKNFISYICFLES-ERWICTASNDATICIYK----QDGF-VPLLTLKGHESTVCAL 114

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
               +    +SGSWDKT R+W ++
Sbjct: 115 SAGLEPRSLISGSWDKTARVWTIS 138


>AF367178-1|AAK31264.1|  747|Drosophila melanogaster chromatin
           assembly factor-1 p105subunit protein.
          Length = 747

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           K L GH   I D+  + +  + +SGS D T  LWD+ +GK+    +DH
Sbjct: 127 KVLRGHREDIYDLSWAPNSQFLVSGSVDNTAMLWDVHSGKSLAILDDH 174


>AF106852-1|AAG21768.1|  787|Drosophila melanogaster phospholipase
           A2 activating proteinhomolog protein.
          Length = 787

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPD---MILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +  KL   L GH+  V  +A  P  P+    ILS SRDK+  VWK      N  +    L
Sbjct: 6   DNYKLSCELLGHSMDVRAVAVGPPTPEGRQTILSGSRDKSTKVWK---PHGNEYLESLTL 62

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
             H +FIS +       +  + S D T+ ++
Sbjct: 63  QDHKNFISYICFLESERWICTASNDATICIY 93



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 22/84 (26%), Positives = 42/84 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+ H  +++ I         I ++S D T+ ++K    ++ + +P   L GH   +  +
Sbjct: 61  TLQDHKNFISYICFLES-ERWICTASNDATICIYK----QDGF-VPLLTLKGHESTVCAL 114

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
               +    +SGSWDKT R+W ++
Sbjct: 115 SAGLEPRSLISGSWDKTARVWTIS 138


>AE014134-219|AAF51402.1|  787|Drosophila melanogaster CG5105-PA
           protein.
          Length = 787

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 28/91 (30%), Positives = 41/91 (45%), Gaps = 3/91 (3%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPD---MILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +  KL   L GH+  V  +A  P  P+    ILS SRDK+  VWK      N  +    L
Sbjct: 6   DNYKLSCELLGHSMDVRAVAVGPPTPEGRQTILSGSRDKSTKVWK---PHGNEYLESLTL 62

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
             H +FIS +       +  + S D T+ ++
Sbjct: 63  QDHKNFISYICFLESERWICTASNDATICIY 93



 Score = 37.9 bits (84), Expect = 0.011
 Identities = 22/84 (26%), Positives = 42/84 (50%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           TL+ H  +++ I         I ++S D T+ ++K    ++ + +P   L GH   +  +
Sbjct: 61  TLQDHKNFISYICFLES-ERWICTASNDATICIYK----QDGF-VPLLTLKGHESTVCAL 114

Query: 248 VLSSDGNYALSGSWDKTLRLWDLA 319
               +    +SGSWDKT R+W ++
Sbjct: 115 SAGLEPRSLISGSWDKTARVWTIS 138


>AE013599-1108|AAF58788.1|  747|Drosophila melanogaster CG12892-PA
           protein.
          Length = 747

 Score = 39.1 bits (87), Expect = 0.005
 Identities = 18/48 (37%), Positives = 27/48 (56%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           K L GH   I D+  + +  + +SGS D T  LWD+ +GK+    +DH
Sbjct: 127 KVLRGHREDIYDLSWAPNSQFLVSGSVDNTAMLWDVHSGKSLAILDDH 174


>AY118871-1|AAM50731.1|  420|Drosophila melanogaster GM29372p
           protein.
          Length = 420

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD-----------EN 190
           S +++     +GH   V  ++ +P       + S D  L VW    D           E+
Sbjct: 181 SNSVECVSVCKGHERGVDSVSVSPDGL-RFATGSWDTMLKVWSAELDDAVEGSSKRMKES 239

Query: 191 NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
               P+  L GH   +S  V   D    L+GSWD TL++WDL+
Sbjct: 240 GVRTPKITLQGHRESVS-AVQWMDATTLLTGSWDHTLKVWDLS 281



 Score = 37.5 bits (83), Expect = 0.015
 Identities = 18/59 (30%), Positives = 31/59 (52%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +S+S+D+T ++W+     N+         GH   +  V +S DG    +GSWD  L++W
Sbjct: 164 VSTSQDQTAMLWQWNVGSNSVECVSV-CKGHERGVDSVSVSPDGLRFATGSWDTMLKVW 221



 Score = 35.1 bits (77), Expect = 0.078
 Identities = 23/84 (27%), Positives = 38/84 (45%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           +R T  GHN WV  +  +     + +S + D    +W    D  +   P   L GH   +
Sbjct: 329 VRNTYLGHNAWVQTVMWSTTEEFLFVSGAYDNQNKLW----DCRSPKAPLYDLLGHGEKV 384

Query: 239 SDVVLSSDGNYALSGSWDKTLRLW 310
            D+  S+   Y +SG  D T+R++
Sbjct: 385 LDIDWSNP-KYIVSGGVDNTVRVF 407


>AY061460-1|AAL29008.1|  730|Drosophila melanogaster LD41760p
           protein.
          Length = 730

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 22/97 (22%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNG-WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           + G+ G ++ ++ ++P  P + +++  D+ +  W     +N  G     +  H   ++ +
Sbjct: 609 MSGNTGKFINKVVSHPTLP-ITITAHEDRHIRFW-----DNTSGTLVHSMVAHLEPVTSL 662

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            + + G Y LSGS D ++RLW+L      +    H K
Sbjct: 663 AVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRK 699


>AF364305-1|AAK48946.1|  730|Drosophila melanogaster DCKA protein.
          Length = 730

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 22/97 (22%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNG-WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           + G+ G ++ ++ ++P  P + +++  D+ +  W     +N  G     +  H   ++ +
Sbjct: 609 MSGNTGKFINKVVSHPTLP-ITITAHEDRHIRFW-----DNTSGTLVHSMVAHLEPVTSL 662

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            + + G Y LSGS D ++RLW+L      +    H K
Sbjct: 663 AVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRK 699


>AF011332-1|AAD01441.1|  730|Drosophila melanogaster WD-40 family
           member protein protein.
          Length = 730

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 22/97 (22%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNG-WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           + G+ G ++ ++ ++P  P + +++  D+ +  W     +N  G     +  H   ++ +
Sbjct: 609 MSGNTGKFINKVVSHPTLP-ITITAHEDRHIRFW-----DNTSGTLVHSMVAHLEPVTSL 662

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            + + G Y LSGS D ++RLW+L      +    H K
Sbjct: 663 AVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRK 699


>AE014134-1952|AAF53009.1|  420|Drosophila melanogaster CG6724-PA
           protein.
          Length = 420

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 29/103 (28%), Positives = 44/103 (42%), Gaps = 11/103 (10%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRD-----------EN 190
           S +++     +GH   V  ++ +P       + S D  L VW    D           E+
Sbjct: 181 SNSVECVSVCKGHERGVDSVSVSPDGL-RFATGSWDTMLKVWSAELDDAVEGSSKRMKES 239

Query: 191 NYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLA 319
               P+  L GH   +S  V   D    L+GSWD TL++WDL+
Sbjct: 240 GVRTPKITLQGHRESVS-AVQWMDATTLLTGSWDHTLKVWDLS 281



 Score = 37.5 bits (83), Expect = 0.015
 Identities = 18/59 (30%), Positives = 31/59 (52%)
 Frame = +2

Query: 134 LSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +S+S+D+T ++W+     N+         GH   +  V +S DG    +GSWD  L++W
Sbjct: 164 VSTSQDQTAMLWQWNVGSNSVECVSV-CKGHERGVDSVSVSPDGLRFATGSWDTMLKVW 221



 Score = 35.1 bits (77), Expect = 0.078
 Identities = 23/84 (27%), Positives = 38/84 (45%)
 Frame = +2

Query: 59  LRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFI 238
           +R T  GHN WV  +  +     + +S + D    +W    D  +   P   L GH   +
Sbjct: 329 VRNTYLGHNAWVQTVMWSTTEEFLFVSGAYDNQNKLW----DCRSPKAPLYDLLGHGEKV 384

Query: 239 SDVVLSSDGNYALSGSWDKTLRLW 310
            D+  S+   Y +SG  D T+R++
Sbjct: 385 LDIDWSNP-KYIVSGGVDNTVRVF 407


>AE014134-1386|AAN10652.1|  730|Drosophila melanogaster CG7392-PD,
           isoform D protein.
          Length = 730

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 22/97 (22%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNG-WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           + G+ G ++ ++ ++P  P + +++  D+ +  W     +N  G     +  H   ++ +
Sbjct: 609 MSGNTGKFINKVVSHPTLP-ITITAHEDRHIRFW-----DNTSGTLVHSMVAHLEPVTSL 662

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            + + G Y LSGS D ++RLW+L      +    H K
Sbjct: 663 AVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRK 699


>AE014134-1385|AAN10651.1|  730|Drosophila melanogaster CG7392-PC,
           isoform C protein.
          Length = 730

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 22/97 (22%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNG-WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           + G+ G ++ ++ ++P  P + +++  D+ +  W     +N  G     +  H   ++ +
Sbjct: 609 MSGNTGKFINKVVSHPTLP-ITITAHEDRHIRFW-----DNTSGTLVHSMVAHLEPVTSL 662

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            + + G Y LSGS D ++RLW+L      +    H K
Sbjct: 663 AVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRK 699


>AE014134-1384|AAF52594.2|  730|Drosophila melanogaster CG7392-PB,
           isoform B protein.
          Length = 730

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 22/97 (22%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNG-WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           + G+ G ++ ++ ++P  P + +++  D+ +  W     +N  G     +  H   ++ +
Sbjct: 609 MSGNTGKFINKVVSHPTLP-ITITAHEDRHIRFW-----DNTSGTLVHSMVAHLEPVTSL 662

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            + + G Y LSGS D ++RLW+L      +    H K
Sbjct: 663 AVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRK 699


>AE014134-1383|AAF52593.2|  730|Drosophila melanogaster CG7392-PA,
           isoform A protein.
          Length = 730

 Score = 37.9 bits (84), Expect = 0.011
 Identities = 22/97 (22%), Positives = 47/97 (48%), Gaps = 1/97 (1%)
 Frame = +2

Query: 71  LRGHNG-WVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           + G+ G ++ ++ ++P  P + +++  D+ +  W     +N  G     +  H   ++ +
Sbjct: 609 MSGNTGKFINKVVSHPTLP-ITITAHEDRHIRFW-----DNTSGTLVHSMVAHLEPVTSL 662

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            + + G Y LSGS D ++RLW+L      +    H K
Sbjct: 663 AVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRK 699


>M76593-1|AAA73103.1|  346|Drosophila melanogaster protein (
           Drosophila melanogasterguanine nucleotide regulatory
           protein beta subunit mRNA,complete cds. ).
          Length = 346

 Score = 37.5 bits (83), Expect = 0.015
 Identities = 27/94 (28%), Positives = 46/94 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G +  ++ +P     I + S DKT  +W + R+E +    ++  +GH   +S V   
Sbjct: 188 GHAGDIAGLSLSPDMKTYI-TGSVDKTAKLWDV-REEGH----KQMFFGHDMDVSSVCYH 241

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             G    S S D+T R++DL A +   ++E   K
Sbjct: 242 PSGFGFASCSEDQTARMYDLRADQQIAQYEPPQK 275



 Score = 34.7 bits (76), Expect = 0.10
 Identities = 21/74 (28%), Positives = 35/74 (47%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++ S D  +  W L +     G+      GH+  I+ + LS D    ++GS DKT +LW
Sbjct: 163 LITGSGDMKICHWDLEK-----GVKTMDFNGHAGDIAGLSLSPDMKTYITGSVDKTAKLW 217

Query: 311 DLAAGKTTRRFEDH 352
           D+      + F  H
Sbjct: 218 DVREEGHKQMFFGH 231



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           L GH + I+ + L  +G    S SWD+ +RLW
Sbjct: 314 LSGHENRITCISLCPNGMCLASTSWDQQVRLW 345



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +K L GH + ++ V  + D  + ++GS D  L +WD
Sbjct: 52  KKILKGHINKVNSVHFAGDSRHCVTGSLDGKLIIWD 87



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 2/94 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLYGHSHFISDVV 250
           GH+  V+ +  +P       S S D+T  ++ L  D+    Y  PQK    ++ F S   
Sbjct: 230 GHDMDVSSVCYHPSGFGFA-SCSEDQTARMYDLRADQQIAQYEPPQK----NTGFTS-CA 283

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LS+ G Y + G  +  +  WD    + T     H
Sbjct: 284 LSTSGRYLMCGGIEGNVHSWDTMKQRHTGTLSGH 317


>AY118886-1|AAM50746.1|  346|Drosophila melanogaster HL07966p
           protein.
          Length = 346

 Score = 37.5 bits (83), Expect = 0.015
 Identities = 27/94 (28%), Positives = 46/94 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G +  ++ +P     I + S DKT  +W + R+E +    ++  +GH   +S V   
Sbjct: 188 GHAGDIAGLSLSPDMKTYI-TGSVDKTAKLWDV-REEGH----KQMFFGHDMDVSSVCYH 241

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             G    S S D+T R++DL A +   ++E   K
Sbjct: 242 PSGFGFASCSEDQTARMYDLRADQQIAQYEPPQK 275



 Score = 34.7 bits (76), Expect = 0.10
 Identities = 21/74 (28%), Positives = 35/74 (47%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++ S D  +  W L +     G+      GH+  I+ + LS D    ++GS DKT +LW
Sbjct: 163 LITGSGDMKICHWDLEK-----GVKTMDFNGHAGDIAGLSLSPDMKTYITGSVDKTAKLW 217

Query: 311 DLAAGKTTRRFEDH 352
           D+      + F  H
Sbjct: 218 DVREEGHKQMFFGH 231



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           L GH + I+ + L  +G    S SWD+ +RLW
Sbjct: 314 LSGHENRITCISLCPNGMCLASTSWDQQVRLW 345



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +K L GH + ++ V  + D  + ++GS D  L +WD
Sbjct: 52  KKILKGHINKVNSVHFAGDSRHCVTGSLDGKLIIWD 87



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 2/94 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLYGHSHFISDVV 250
           GH+  V+ +  +P       S S D+T  ++ L  D+    Y  PQK    ++ F S   
Sbjct: 230 GHDMDVSSVCYHPSGFGFA-SCSEDQTARMYDLRADQQIAQYEPPQK----NTGFTS-CA 283

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LS+ G Y + G  +  +  WD    + T     H
Sbjct: 284 LSTSGRYLMCGGIEGNVHSWDTMKQRHTGTLSGH 317


>AF160909-1|AAD46849.2|  386|Drosophila melanogaster LD03471p
           protein.
          Length = 386

 Score = 37.5 bits (83), Expect = 0.015
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIA-TNPKYPDMILSSSRDKTLIVWKLT 178
           K    L+GH G V Q+A  +PK+ +++ S S D+ +IVWK T
Sbjct: 77  KALAELKGHQGPVWQVAWAHPKFGNILASCSYDRKVIVWKST 118


>AE014297-3318|AAF56128.1|  356|Drosophila melanogaster CG6773-PA
           protein.
          Length = 356

 Score = 37.5 bits (83), Expect = 0.015
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = +2

Query: 56  KLRGTLRGHNGWVTQIA-TNPKYPDMILSSSRDKTLIVWKLT 178
           K    L+GH G V Q+A  +PK+ +++ S S D+ +IVWK T
Sbjct: 47  KALAELKGHQGPVWQVAWAHPKFGNILASCSYDRKVIVWKST 88


>AE014296-3197|AAF49124.1|  346|Drosophila melanogaster CG8770-PA
           protein.
          Length = 346

 Score = 37.5 bits (83), Expect = 0.015
 Identities = 27/94 (28%), Positives = 46/94 (48%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH G +  ++ +P     I + S DKT  +W + R+E +    ++  +GH   +S V   
Sbjct: 188 GHAGDIAGLSLSPDMKTYI-TGSVDKTAKLWDV-REEGH----KQMFFGHDMDVSSVCYH 241

Query: 257 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
             G    S S D+T R++DL A +   ++E   K
Sbjct: 242 PSGFGFASCSEDQTARMYDLRADQQIAQYEPPQK 275



 Score = 34.7 bits (76), Expect = 0.10
 Identities = 21/74 (28%), Positives = 35/74 (47%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +++ S D  +  W L +     G+      GH+  I+ + LS D    ++GS DKT +LW
Sbjct: 163 LITGSGDMKICHWDLEK-----GVKTMDFNGHAGDIAGLSLSPDMKTYITGSVDKTAKLW 217

Query: 311 DLAAGKTTRRFEDH 352
           D+      + F  H
Sbjct: 218 DVREEGHKQMFFGH 231



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +2

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           L GH + I+ + L  +G    S SWD+ +RLW
Sbjct: 314 LSGHENRITCISLCPNGMCLASTSWDQQVRLW 345



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 12/36 (33%), Positives = 21/36 (58%)
 Frame = +2

Query: 206 QKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           +K L GH + ++ V  + D  + ++GS D  L +WD
Sbjct: 52  KKILKGHINKVNSVHFAGDSRHCVTGSLDGKLIIWD 87



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 2/94 (2%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLYGHSHFISDVV 250
           GH+  V+ +  +P       S S D+T  ++ L  D+    Y  PQK    ++ F S   
Sbjct: 230 GHDMDVSSVCYHPSGFGFA-SCSEDQTARMYDLRADQQIAQYEPPQK----NTGFTS-CA 283

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           LS+ G Y + G  +  +  WD    + T     H
Sbjct: 284 LSTSGRYLMCGGIEGNVHSWDTMKQRHTGTLSGH 317


>BT022923-1|AAY55339.1|  361|Drosophila melanogaster IP11251p
           protein.
          Length = 361

 Score = 37.1 bits (82), Expect = 0.019
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 7/91 (7%)
 Frame = +2

Query: 101 IATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLY---GHSHFISDVVLSSDG 265
           +A  P   D+  ++S D +L +W     E+  N   P++ L    GH + +  +      
Sbjct: 98  VAWCPYAADIAATASGDGSLQIWCGLDGESASNQLTPKQPLICLQGHKNGVYSLDWGEKW 157

Query: 266 NY--ALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           NY   LSGSWD TL+LWD     +   F  H
Sbjct: 158 NYHTLLSGSWDCTLKLWDCNRQNSITTFVGH 188


>BT022304-1|AAY54720.1|  364|Drosophila melanogaster IP11351p
           protein.
          Length = 364

 Score = 37.1 bits (82), Expect = 0.019
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 7/91 (7%)
 Frame = +2

Query: 101 IATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLY---GHSHFISDVVLSSDG 265
           +A  P   D+  ++S D +L +W     E+  N   P++ L    GH + +  +      
Sbjct: 101 VAWCPYAADIAATASGDGSLQIWCGLDGESASNQLTPKQPLICLQGHKNGVYSLDWGEKW 160

Query: 266 NY--ALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           NY   LSGSWD TL+LWD     +   F  H
Sbjct: 161 NYHTLLSGSWDCTLKLWDCNRQNSITTFVGH 191


>BT015954-1|AAV36839.1|  462|Drosophila melanogaster SD11903p
           protein.
          Length = 462

 Score = 37.1 bits (82), Expect = 0.019
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   + ++  +P  P ++LS S+D +L +W +  D          + GH   +  V   
Sbjct: 209 GHGHAINELKFHPTRPQLLLSGSKDHSLRLWNIQSDV--CVAVFGGVEGHRDEVLSVDFD 266

Query: 257 SDGNYALSGSWDKTLRLWDL 316
             G+  +S   D +L+LW L
Sbjct: 267 LRGDRIMSSGMDHSLKLWRL 286


>AE014134-2122|AAF53141.1|  462|Drosophila melanogaster CG5202-PA,
           isoform A protein.
          Length = 462

 Score = 37.1 bits (82), Expect = 0.019
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = +2

Query: 77  GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS 256
           GH   + ++  +P  P ++LS S+D +L +W +  D          + GH   +  V   
Sbjct: 209 GHGHAINELKFHPTRPQLLLSGSKDHSLRLWNIQSDV--CVAVFGGVEGHRDEVLSVDFD 266

Query: 257 SDGNYALSGSWDKTLRLWDL 316
             G+  +S   D +L+LW L
Sbjct: 267 LRGDRIMSSGMDHSLKLWRL 286


>M20571-1|AAA28512.1|  719|Drosophila melanogaster protein (
           D.melanogaster enhancerof split mRNA, complete cds. ).
          Length = 719

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 27/118 (22%), Positives = 52/118 (44%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G +S    +   S T +++  L         +A +P    +  S   D  + VW L  + 
Sbjct: 498 GEASNLSIWDLASPTPRIKAELTSAAPACYALAISPD-SKVCFSCCSDGNIAVWDLHNE- 555

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
               I  ++  GH+   S + +S DG+   +G  D T+R WDL  G+  ++ +  +++
Sbjct: 556 ----ILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQI 609



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           VW +++  N   + Q       ++I  V L  DG   + G     L +WDLA+
Sbjct: 458 VWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLAS 510


>BT016114-1|AAV36999.1|  949|Drosophila melanogaster LD10780p
           protein.
          Length = 949

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +2

Query: 125 DMILSSSRD-KTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           D +  +SR+   L+VW+   ++  Y + Q+   GHS  ++ +  SSDG +  +G  D  +
Sbjct: 363 DWVALASREIGQLLVWEWQSEQ--YIMKQQ---GHSSEMTCIAYSSDGQFIATGGEDSKV 417

Query: 302 RLWDLAAGKTTRRFEDHT 355
           +LW+  +      F +HT
Sbjct: 418 KLWNTQSSFCFVTFSEHT 435



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 2/33 (6%)
 Frame = +2

Query: 221 GHSHFISDVVLS--SDGNYALSGSWDKTLRLWD 313
           GH   +  +  S  +  +  +SGSWDKT+++W+
Sbjct: 519 GHEGPVVSIAFSPVATSSTLVSGSWDKTVKIWN 551


>AY118520-1|AAM49889.1|  484|Drosophila melanogaster LD17611p
           protein.
          Length = 484

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 24/90 (26%), Positives = 45/90 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T+K   TL+GH   V  +       D+  S+++D+++ +W L  DE  Y    + L+GH
Sbjct: 244 QTMKHIKTLKGHRDSVAGLVFRKGTHDLY-SAAKDRSVKIWSL--DEMAY---VESLFGH 297

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
              ++ +   S      +G  D +LR+W +
Sbjct: 298 QTAVTSIDALSRERAITAGGSDCSLRIWKI 327


>AY061000-1|AAL28548.1|  328|Drosophila melanogaster HL01517p
           protein.
          Length = 328

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 18/37 (48%), Positives = 19/37 (51%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           GH   +  V  S DG    SGS D TLRLW    GKT
Sbjct: 267 GHFGPVHSVKFSPDGELYASGSEDGTLRLWQTTVGKT 303



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 20/72 (27%), Positives = 35/72 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I++ S +K + V+ L + E     P++   GH+  I   +        +S + DKT+RLW
Sbjct: 118 IVTGSNEKLVRVFNLEQPEAQ---PEEYA-GHTGAIKRALFCRGDKCIISAAEDKTVRLW 173

Query: 311 DLAAGKTTRRFE 346
           D   G   +R +
Sbjct: 174 DRMTGIEVQRLQ 185


>AY052019-1|AAK93443.1|  794|Drosophila melanogaster LD47515p
           protein.
          Length = 794

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 6/92 (6%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDM---ILSSSRDKTLIVWKLTRDENNYGIPQKR--- 214
           + L   L GH GW+  +  + K PD    +LS+S DKT+I+W  T  E    + + R   
Sbjct: 278 VSLESVLYGHEGWIYGVHWH-KTPDQELRLLSASIDKTVIIWAPT--EEGIWLEEVRVGE 334

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + G+S        S DG+  ++ S+     +W
Sbjct: 335 VGGNSVGFYGGKFSGDGHSIMAHSYQGGFHIW 366


>AY051929-1|AAK93353.1|  509|Drosophila melanogaster LD41216p
           protein.
          Length = 509

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           K   GHS F+++   + DG+  LS S D T+++W L
Sbjct: 343 KEFKGHSSFVNEATFTPDGHSVLSASSDGTVKVWSL 378



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 12/40 (30%), Positives = 19/40 (47%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           +G    +     S DG Y ++GS D  L +W+   GK  +
Sbjct: 211 FGQKSHVECAQFSPDGQYLITGSVDGFLEVWNFTTGKVRK 250



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIP---QKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           +++ S D  L VW  T  +    +    Q +       +  +  S D     SG+ D  +
Sbjct: 229 LITGSVDGFLEVWNFTTGKVRKDLKYQAQDQFMMMEQAVLALNFSRDSEMVASGAQDGQI 288

Query: 302 RLWDLAAGKTTRRFED-HTK 358
           ++W +  G+  R+FE  HTK
Sbjct: 289 KVWRIITGQCLRKFEKAHTK 308


>AF346730-1|AAK50884.1|  942|Drosophila melanogaster cannonball
           protein.
          Length = 942

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M +  K    L+GH   +     +P    M   S+ D T+ +W + +        Q R++
Sbjct: 696 MQDNTKPARILQGHLAELGVCLFHPNRHYMATGSA-DCTVRIWDIVK------AVQVRIF 748

Query: 221 -GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            GH   I+ ++ S  G Y +SG  D  + +WD  A +   +F DH K
Sbjct: 749 RGHKSRITALIYSICGRYLVSGGDDNLIMIWD-TANEILMQFFDHHK 794



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 21/72 (29%), Positives = 33/72 (45%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ++S D T  VW   +D      P + L GH   +   +   + +Y  +GS D T+R+WD+
Sbjct: 685 TASDDCTARVWM--QDNTK---PARILQGHLAELGVCLFHPNRHYMATGSADCTVRIWDI 739

Query: 317 AAGKTTRRFEDH 352
                 R F  H
Sbjct: 740 VKAVQVRIFRGH 751


>AF145695-1|AAD38670.1|  719|Drosophila melanogaster BcDNA.LD33829
           protein.
          Length = 719

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 27/118 (22%), Positives = 52/118 (44%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G +S    +   S T +++  L         +A +P    +  S   D  + VW L  + 
Sbjct: 498 GEASNLSIWDLASPTPRIKAELTSAAPACYALAISPD-SKVCFSCCSDGNIAVWDLHNE- 555

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
               I  ++  GH+   S + +S DG+   +G  D T+R WDL  G+  ++ +  +++
Sbjct: 556 ----ILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQI 609



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           VW +++  N   + Q       ++I  V L  DG   + G     L +WDLA+
Sbjct: 458 VWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLAS 510


>AE014297-3908|AAN14069.1|  719|Drosophila melanogaster CG8384-PD,
           isoform D protein.
          Length = 719

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 27/118 (22%), Positives = 52/118 (44%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G +S    +   S T +++  L         +A +P    +  S   D  + VW L  + 
Sbjct: 498 GEASNLSIWDLASPTPRIKAELTSAAPACYALAISPD-SKVCFSCCSDGNIAVWDLHNE- 555

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
               I  ++  GH+   S + +S DG+   +G  D T+R WDL  G+  ++ +  +++
Sbjct: 556 ----ILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQI 609



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           VW +++  N   + Q       ++I  V L  DG   + G     L +WDLA+
Sbjct: 458 VWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLAS 510


>AE014297-3907|AAN14068.1|  719|Drosophila melanogaster CG8384-PC,
           isoform C protein.
          Length = 719

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 27/118 (22%), Positives = 52/118 (44%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G +S    +   S T +++  L         +A +P    +  S   D  + VW L  + 
Sbjct: 498 GEASNLSIWDLASPTPRIKAELTSAAPACYALAISPD-SKVCFSCCSDGNIAVWDLHNE- 555

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
               I  ++  GH+   S + +S DG+   +G  D T+R WDL  G+  ++ +  +++
Sbjct: 556 ----ILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQI 609



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           VW +++  N   + Q       ++I  V L  DG   + G     L +WDLA+
Sbjct: 458 VWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLAS 510


>AE014297-3906|AAF56556.1|  719|Drosophila melanogaster CG8384-PB,
           isoform B protein.
          Length = 719

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 27/118 (22%), Positives = 52/118 (44%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G +S    +   S T +++  L         +A +P    +  S   D  + VW L  + 
Sbjct: 498 GEASNLSIWDLASPTPRIKAELTSAAPACYALAISPD-SKVCFSCCSDGNIAVWDLHNE- 555

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
               I  ++  GH+   S + +S DG+   +G  D T+R WDL  G+  ++ +  +++
Sbjct: 556 ----ILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQI 609



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           VW +++  N   + Q       ++I  V L  DG   + G     L +WDLA+
Sbjct: 458 VWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLAS 510


>AE014297-3905|AAF56557.1|  719|Drosophila melanogaster CG8384-PA,
           isoform A protein.
          Length = 719

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 27/118 (22%), Positives = 52/118 (44%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G +S    +   S T +++  L         +A +P    +  S   D  + VW L  + 
Sbjct: 498 GEASNLSIWDLASPTPRIKAELTSAAPACYALAISPD-SKVCFSCCSDGNIAVWDLHNE- 555

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
               I  ++  GH+   S + +S DG+   +G  D T+R WDL  G+  ++ +  +++
Sbjct: 556 ----ILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQI 609



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           VW +++  N   + Q       ++I  V L  DG   + G     L +WDLA+
Sbjct: 458 VWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLAS 510


>AE014297-3904|AAS65218.1|  730|Drosophila melanogaster CG8384-PE,
           isoform E protein.
          Length = 730

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 27/118 (22%), Positives = 52/118 (44%)
 Frame = +2

Query: 8   GXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDE 187
           G +S    +   S T +++  L         +A +P    +  S   D  + VW L  + 
Sbjct: 509 GEASNLSIWDLASPTPRIKAELTSAAPACYALAISPD-SKVCFSCCSDGNIAVWDLHNE- 566

Query: 188 NNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKV 361
               I  ++  GH+   S + +S DG+   +G  D T+R WDL  G+  ++ +  +++
Sbjct: 567 ----ILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQI 620



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 15/53 (28%), Positives = 24/53 (45%)
 Frame = +2

Query: 164 VWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           VW +++  N   + Q       ++I  V L  DG   + G     L +WDLA+
Sbjct: 469 VWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLAS 521


>AE014297-2605|AAF55614.2|  509|Drosophila melanogaster CG5451-PA
           protein.
          Length = 509

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 14/36 (38%), Positives = 22/36 (61%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           K   GHS F+++   + DG+  LS S D T+++W L
Sbjct: 343 KEFKGHSSFVNEATFTPDGHSVLSASSDGTVKVWSL 378



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 12/40 (30%), Positives = 19/40 (47%)
 Frame = +2

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           +G    +     S DG Y ++GS D  L +W+   GK  +
Sbjct: 211 FGQKSHVECAQFSPDGQYLITGSVDGFLEVWNFTTGKVRK 250



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 20/80 (25%), Positives = 35/80 (43%), Gaps = 4/80 (5%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIP---QKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           +++ S D  L VW  T  +    +    Q +       +  +  S D     SG+ D  +
Sbjct: 229 LITGSVDGFLEVWNFTTGKVRKDLKYQAQDQFMMMEQAVLALNFSRDSEMVASGAQDGQI 288

Query: 302 RLWDLAAGKTTRRFED-HTK 358
           ++W +  G+  R+FE  HTK
Sbjct: 289 KVWRIITGQCLRKFEKAHTK 308


>AE014296-1810|AAF50162.1|  942|Drosophila melanogaster CG6577-PA
           protein.
          Length = 942

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLY 220
           M +  K    L+GH   +     +P    M   S+ D T+ +W + +        Q R++
Sbjct: 696 MQDNTKPARILQGHLAELGVCLFHPNRHYMATGSA-DCTVRIWDIVK------AVQVRIF 748

Query: 221 -GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
            GH   I+ ++ S  G Y +SG  D  + +WD  A +   +F DH K
Sbjct: 749 RGHKSRITALIYSICGRYLVSGGDDNLIMIWD-TANEILMQFFDHHK 794



 Score = 33.1 bits (72), Expect = 0.32
 Identities = 21/72 (29%), Positives = 33/72 (45%)
 Frame = +2

Query: 137 SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           ++S D T  VW   +D      P + L GH   +   +   + +Y  +GS D T+R+WD+
Sbjct: 685 TASDDCTARVWM--QDNTK---PARILQGHLAELGVCLFHPNRHYMATGSADCTVRIWDI 739

Query: 317 AAGKTTRRFEDH 352
                 R F  H
Sbjct: 740 VKAVQVRIFRGH 751


>AE013599-3624|AAF47023.1|  328|Drosophila melanogaster CG3957-PA
           protein.
          Length = 328

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 18/37 (48%), Positives = 19/37 (51%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKT 331
           GH   +  V  S DG    SGS D TLRLW    GKT
Sbjct: 267 GHFGPVHSVKFSPDGELYASGSEDGTLRLWQTTVGKT 303



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 20/72 (27%), Positives = 35/72 (48%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           I++ S +K + V+ L + E     P++   GH+  I   +        +S + DKT+RLW
Sbjct: 118 IVTGSNEKLVRVFNLEQPEAQ---PEEYA-GHTGAIKRALFCRGDKCIISAAEDKTVRLW 173

Query: 311 DLAAGKTTRRFE 346
           D   G   +R +
Sbjct: 174 DRMTGIEVQRLQ 185


>AE013599-1970|AAX52704.1|  484|Drosophila melanogaster CG33505-PA
           protein.
          Length = 484

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 24/90 (26%), Positives = 45/90 (50%)
 Frame = +2

Query: 47  ETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGH 226
           +T+K   TL+GH   V  +       D+  S+++D+++ +W L  DE  Y    + L+GH
Sbjct: 244 QTMKHIKTLKGHRDSVAGLVFRKGTHDLY-SAAKDRSVKIWSL--DEMAY---VESLFGH 297

Query: 227 SHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
              ++ +   S      +G  D +LR+W +
Sbjct: 298 QTAVTSIDALSRERAITAGGSDCSLRIWKI 327


>AE013599-1182|AAF58744.1|  949|Drosophila melanogaster CG12325-PA
           protein.
          Length = 949

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 1/78 (1%)
 Frame = +2

Query: 125 DMILSSSRD-KTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTL 301
           D +  +SR+   L+VW+   ++  Y + Q+   GHS  ++ +  SSDG +  +G  D  +
Sbjct: 363 DWVALASREIGQLLVWEWQSEQ--YIMKQQ---GHSSEMTCIAYSSDGQFIATGGEDSKV 417

Query: 302 RLWDLAAGKTTRRFEDHT 355
           +LW+  +      F +HT
Sbjct: 418 KLWNTQSSFCFVTFSEHT 435



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 2/33 (6%)
 Frame = +2

Query: 221 GHSHFISDVVLS--SDGNYALSGSWDKTLRLWD 313
           GH   +  +  S  +  +  +SGSWDKT+++W+
Sbjct: 519 GHEGPVVSIAFSPVATSSTLVSGSWDKTVKIWN 551


>AE013599-1156|AAF58765.2|  794|Drosophila melanogaster CG11887-PA
           protein.
          Length = 794

 Score = 36.3 bits (80), Expect = 0.034
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 6/92 (6%)
 Frame = +2

Query: 53  LKLRGTLRGHNGWVTQIATNPKYPDM---ILSSSRDKTLIVWKLTRDENNYGIPQKR--- 214
           + L   L GH GW+  +  + K PD    +LS+S DKT+I+W  T  E    + + R   
Sbjct: 278 VSLESVLYGHEGWIYGVHWH-KTPDQELRLLSASIDKTVIIWAPT--EEGIWLEEVRVGE 334

Query: 215 LYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + G+S        S DG+  ++ S+     +W
Sbjct: 335 VGGNSVGFYGGKFSGDGHSIMAHSYQGGFHIW 366


>AY118857-1|AAM50717.1|  320|Drosophila melanogaster GM21396p
           protein.
          Length = 320

 Score = 35.9 bits (79), Expect = 0.045
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
           + S S DKT++V+ L RD    G   +   GH+  +  +    ++ +   + S DKT+R+
Sbjct: 43  LASGSFDKTVVVYSLERDRFLKGNTYR---GHTASVDQLCWHRTNPDQFATASGDKTVRI 99

Query: 308 WDLAAGK 328
           WD+  GK
Sbjct: 100 WDIRVGK 106



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
 Frame = +2

Query: 59  LRG-TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           L+G T RGH   V Q+  +   PD   ++S DKT+ +W +
Sbjct: 63  LKGNTYRGHTASVDQLCWHRTNPDQFATASGDKTVRIWDI 102



 Score = 28.7 bits (61), Expect = 6.8
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           H   +  V  ++DG Y  SGS+DKT+ ++ L
Sbjct: 27  HMSKVHSVCWNADGRYLASGSFDKTVVVYSL 57


>AY118568-1|AAM49937.2|  360|Drosophila melanogaster LD40776p
           protein.
          Length = 360

 Score = 35.9 bits (79), Expect = 0.045
 Identities = 20/66 (30%), Positives = 36/66 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + +++ S D T+  W++  ++N   +P K +      + DV  S DG+     S DK ++
Sbjct: 51  NFLVAGSWDSTVRCWEV--EQNGATVP-KSMKTMGGPVLDVCWSDDGSKVFVASCDKQVK 107

Query: 305 LWDLAA 322
           LWDLA+
Sbjct: 108 LWDLAS 113



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 17/61 (27%), Positives = 28/61 (45%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +  +S DK + +W L  D+    + Q   +        +V        ++GSWDKTL+ W
Sbjct: 97  VFVASCDKQVKLWDLASDQ----VMQVAAHDGPVKTCHMVKGPTYTCLMTGSWDKTLKFW 152

Query: 311 D 313
           D
Sbjct: 153 D 153



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTT 334
           N+ ++GSWD T+R W++     T
Sbjct: 51  NFLVAGSWDSTVRCWEVEQNGAT 73


>AJ556819-1|CAD89224.1|  320|Drosophila melanogaster Tex protein
           protein.
          Length = 320

 Score = 35.9 bits (79), Expect = 0.045
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
           + S S DKT++V+ L RD    G   +   GH+  +  +    ++ +   + S DKT+R+
Sbjct: 43  LASGSFDKTVVVYSLERDRFLKGNTYR---GHTASVDQLCWHRTNPDQFATASGDKTVRI 99

Query: 308 WDLAAGK 328
           WD+  GK
Sbjct: 100 WDIRVGK 106



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
 Frame = +2

Query: 59  LRG-TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           L+G T RGH   V Q+  +   PD   ++S DKT+ +W +
Sbjct: 63  LKGNTYRGHTASVDQLCWHRTNPDQFATASGDKTVRIWDI 102



 Score = 28.7 bits (61), Expect = 6.8
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           H   +  V  ++DG Y  SGS+DKT+ ++ L
Sbjct: 27  HMSKVHSVCWNADGRYLASGSFDKTVVVYSL 57


>AE014297-4400|AAF56906.1|  436|Drosophila melanogaster CG7568-PA
           protein.
          Length = 436

 Score = 35.9 bits (79), Expect = 0.045
 Identities = 22/78 (28%), Positives = 37/78 (47%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS 259
           H+G     A   +   M+L+ S D +  +W +      +     +L GHS  +S+ V + 
Sbjct: 234 HHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLGH-----QLRGHSAELSNCVWNF 288

Query: 260 DGNYALSGSWDKTLRLWD 313
            G+   +GS D T R+WD
Sbjct: 289 SGSLIATGSLDNTARIWD 306



 Score = 35.1 bits (77), Expect = 0.078
 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLY-GHSHFISDVVLSSDGNYALSGSWDKTLR 304
           ++ + S D T  VW+L   E +  +    L  GHS  +S V  S  G   L+ S D T R
Sbjct: 335 LLATCSSDCTARVWRL---EGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTAR 391

Query: 305 LWDLAAGKTTRRFEDH 352
           LW   +G+ ++    H
Sbjct: 392 LWLTESGQCSQVLAGH 407



 Score = 33.9 bits (74), Expect = 0.18
 Identities = 25/89 (28%), Positives = 42/89 (47%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S  L++   + GH+  V+++  +P    M+L++S D T  +W LT      G   + L G
Sbjct: 353 SSELEMLSLMAGHSDEVSKVCFSPS-GCMLLTASADNTARLW-LTES----GQCSQVLAG 406

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           H   +     S  G+  L+ S D + R W
Sbjct: 407 HEGEVFSCAYSYAGDAILTASKDNSCRFW 435


>AE014297-731|AAF54217.1|  320|Drosophila melanogaster CG9615-PA
           protein.
          Length = 320

 Score = 35.9 bits (79), Expect = 0.045
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 1/67 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLS-SDGNYALSGSWDKTLRL 307
           + S S DKT++V+ L RD    G   +   GH+  +  +    ++ +   + S DKT+R+
Sbjct: 43  LASGSFDKTVVVYSLERDRFLKGNTYR---GHTASVDQLCWHRTNPDQFATASGDKTVRI 99

Query: 308 WDLAAGK 328
           WD+  GK
Sbjct: 100 WDIRVGK 106



 Score = 32.3 bits (70), Expect = 0.55
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 1/40 (2%)
 Frame = +2

Query: 59  LRG-TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           L+G T RGH   V Q+  +   PD   ++S DKT+ +W +
Sbjct: 63  LKGNTYRGHTASVDQLCWHRTNPDQFATASGDKTVRIWDI 102



 Score = 28.7 bits (61), Expect = 6.8
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           H   +  V  ++DG Y  SGS+DKT+ ++ L
Sbjct: 27  HMSKVHSVCWNADGRYLASGSFDKTVVVYSL 57


>AE013599-3245|AAF46745.1|  346|Drosophila melanogaster CG9862-PA
           protein.
          Length = 346

 Score = 35.9 bits (79), Expect = 0.045
 Identities = 20/66 (30%), Positives = 36/66 (54%)
 Frame = +2

Query: 125 DMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLR 304
           + +++ S D T+  W++  ++N   +P K +      + DV  S DG+     S DK ++
Sbjct: 37  NFLVAGSWDSTVRCWEV--EQNGATVP-KSMKTMGGPVLDVCWSDDGSKVFVASCDKQVK 93

Query: 305 LWDLAA 322
           LWDLA+
Sbjct: 94  LWDLAS 99



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 17/61 (27%), Positives = 28/61 (45%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           +  +S DK + +W L  D+    + Q   +        +V        ++GSWDKTL+ W
Sbjct: 83  VFVASCDKQVKLWDLASDQ----VMQVAAHDGPVKTCHMVKGPTYTCLMTGSWDKTLKFW 138

Query: 311 D 313
           D
Sbjct: 139 D 139



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 9/23 (39%), Positives = 15/23 (65%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTT 334
           N+ ++GSWD T+R W++     T
Sbjct: 37  NFLVAGSWDSTVRCWEVEQNGAT 59


>BT011095-1|AAR82761.1|  398|Drosophila melanogaster RE32047p
           protein.
          Length = 398

 Score = 35.1 bits (77), Expect = 0.078
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 2/78 (2%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYG--HSHFISDVVLSSDGNYALSGSWDKTL 301
           M +S S+D+T+  W L  + +   +   R  G   S  ++ V +   G   +SG  D + 
Sbjct: 243 MFVSGSQDQTIRFWDLRVNVSVNTLDNDRKDGGLESSAVTAVCVDPTGRLLVSGHADSSC 302

Query: 302 RLWDLAAGKTTRRFEDHT 355
            L+D+   +  +RF  HT
Sbjct: 303 TLYDIRGNRPIQRFYPHT 320



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +2

Query: 197 GIPQKRLYGHS-HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           G P +   GH+ H +S  + S +    +SGS D+T+R WDL    +    ++  K
Sbjct: 220 GTPFQAYSGHTGHILS--LYSWNNAMFVSGSQDQTIRFWDLRVNVSVNTLDNDRK 272



 Score = 28.7 bits (61), Expect = 6.8
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           P +R Y H+  I  V  S    Y L+ S+D ++RL DL
Sbjct: 312 PIQRFYPHTAEIRCVRFSPSAYYMLTCSYDNSIRLTDL 349


>AE013599-3730|AAF47100.1|  348|Drosophila melanogaster CG2812-PA
           protein.
          Length = 348

 Score = 35.1 bits (77), Expect = 0.078
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 2/78 (2%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYG--HSHFISDVVLSSDGNYALSGSWDKTL 301
           M +S S+D+T+  W L  + +   +   R  G   S  ++ V +   G   +SG  D + 
Sbjct: 193 MFVSGSQDQTIRFWDLRVNVSVNTLDNDRKDGGLESSAVTAVCVDPTGRLLVSGHADSSC 252

Query: 302 RLWDLAAGKTTRRFEDHT 355
            L+D+   +  +RF  HT
Sbjct: 253 TLYDIRGNRPIQRFYPHT 270



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = +2

Query: 197 GIPQKRLYGHS-HFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTK 358
           G P +   GH+ H +S  + S +    +SGS D+T+R WDL    +    ++  K
Sbjct: 170 GTPFQAYSGHTGHILS--LYSWNNAMFVSGSQDQTIRFWDLRVNVSVNTLDNDRK 222



 Score = 28.7 bits (61), Expect = 6.8
 Identities = 15/38 (39%), Positives = 21/38 (55%)
 Frame = +2

Query: 203 PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           P +R Y H+  I  V  S    Y L+ S+D ++RL DL
Sbjct: 262 PIQRFYPHTAEIRCVRFSPSAYYMLTCSYDNSIRLTDL 299


>U22419-1|AAA83150.1|  526|Drosophila melanogaster fzy protein.
          Length = 526

 Score = 34.7 bits (76), Expect = 0.10
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +2

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           + Q  L GH+  +  + +S DG+  +S   D+TLRLW+  A
Sbjct: 461 VKQADLTGHTSRVLQMAMSPDGSTVISAGADETLRLWNCFA 501



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+  +LR  + GH+  V  +A N     ++ S SRD T++   +   E+        L G
Sbjct: 281 SKVKRLR-VMDGHSARVGSLAWNSF---LVSSGSRDGTIVHHDVRAREHKLST----LSG 332

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           H+  +  +  S+D  Y  SG  D  + +W  A+G
Sbjct: 333 HTQEVCGLKWSTDFKYLASGGNDNLVNVWSAASG 366


>BT029432-1|ABK57089.1|  526|Drosophila melanogaster LD44795p
           protein.
          Length = 526

 Score = 34.7 bits (76), Expect = 0.10
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +2

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           + Q  L GH+  +  + +S DG+  +S   D+TLRLW+  A
Sbjct: 461 VKQADLTGHTSRVLQMAMSPDGSTVISAGADETLRLWNCFA 501



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+  +LR  + GH+  V  +A N     ++ S SRD T++   +   E+        L G
Sbjct: 281 SKVKRLR-VMDGHSARVGSLAWNSF---LVSSGSRDGTIVHHDVRAREHKLST----LSG 332

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           H+  +  +  S+D  Y  SG  D  + +W  A+G
Sbjct: 333 HTQEVCGLKWSTDFKYLASGGNDNLVNVWSAASG 366


>BT010249-1|AAQ23567.1|  526|Drosophila melanogaster RE39287p
           protein.
          Length = 526

 Score = 34.7 bits (76), Expect = 0.10
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +2

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           + Q  L GH+  +  + +S DG+  +S   D+TLRLW+  A
Sbjct: 461 VKQADLTGHTSRVLQMAMSPDGSTVISAGADETLRLWNCFA 501



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+  +LR  + GH+  V  +A N     ++ S SRD T++   +   E+        L G
Sbjct: 281 SKVKRLR-VMDGHSARVGSLAWNSF---LVSSGSRDGTIVHHDVRAREHKLST----LSG 332

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           H+  +  +  S+D  Y  SG  D  + +W  A+G
Sbjct: 333 HTQEVCGLKWSTDFKYLASGGNDNLVNVWSAASG 366


>AE014298-868|AAF46145.1|  424|Drosophila melanogaster CG15897-PA
           protein.
          Length = 424

 Score = 34.7 bits (76), Expect = 0.10
 Identities = 28/93 (30%), Positives = 43/93 (46%), Gaps = 1/93 (1%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIV-WKLTRDENNYGIPQKRLYGHSHFISDV 247
           L GH   V  I  +     +I     DK  +  +  T D ++Y +      GH  F+S +
Sbjct: 182 LLGHLSVVYDILWSEDQQHIITCDRDDKIRVTNYPATFDIHSYCL------GHREFVSGL 235

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAGKTTRRFE 346
            L ++ + A S S DKTLR+W+   GK   + E
Sbjct: 236 ALLTEQHIA-SASGDKTLRVWNYIQGKELLQHE 267


>AE014134-2699|AAF53523.1|  526|Drosophila melanogaster CG4274-PA
           protein.
          Length = 526

 Score = 34.7 bits (76), Expect = 0.10
 Identities = 15/41 (36%), Positives = 24/41 (58%)
 Frame = +2

Query: 200 IPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAA 322
           + Q  L GH+  +  + +S DG+  +S   D+TLRLW+  A
Sbjct: 461 VKQADLTGHTSRVLQMAMSPDGSTVISAGADETLRLWNCFA 501



 Score = 34.3 bits (75), Expect = 0.14
 Identities = 26/94 (27%), Positives = 44/94 (46%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYG 223
           S+  +LR  + GH+  V  +A N     ++ S SRD T++   +   E+        L G
Sbjct: 281 SKVKRLR-VMDGHSARVGSLAWNSF---LVSSGSRDGTIVHHDVRAREHKLST----LSG 332

Query: 224 HSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAG 325
           H+  +  +  S+D  Y  SG  D  + +W  A+G
Sbjct: 333 HTQEVCGLKWSTDFKYLASGGNDNLVNVWSAASG 366


>AY118560-1|AAM49929.1|  528|Drosophila melanogaster LD37992p
           protein.
          Length = 528

 Score = 34.3 bits (75), Expect = 0.14
 Identities = 27/123 (21%), Positives = 47/123 (38%), Gaps = 3/123 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           A G + +  P +K+         + GH G V  IA  P   ++I S S D  + VW++  
Sbjct: 54  AGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPD 113

Query: 182 D--ENNYGIPQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                    P   L  H   +  V+      N  L+   D  + +W++  G+     + H
Sbjct: 114 GGLSRTLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSH 173

Query: 353 TKV 361
             +
Sbjct: 174 PDI 176


>AY069081-1|AAL39226.1|  317|Drosophila melanogaster GH09638p
           protein.
          Length = 317

 Score = 34.3 bits (75), Expect = 0.14
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH+  +  + +S   +  LSGS DKTLRLWDL
Sbjct: 107 GHTKKVISLCISPVEDTFLSGSLDKTLRLWDL 138


>AF467271-1|AAM74566.1|  528|Drosophila melanogaster coronin
           protein.
          Length = 528

 Score = 34.3 bits (75), Expect = 0.14
 Identities = 27/123 (21%), Positives = 47/123 (38%), Gaps = 3/123 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           A G + +  P +K+         + GH G V  IA  P   ++I S S D  + VW++  
Sbjct: 54  AGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPD 113

Query: 182 D--ENNYGIPQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                    P   L  H   +  V+      N  L+   D  + +W++  G+     + H
Sbjct: 114 GGLSRTLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSH 173

Query: 353 TKV 361
             +
Sbjct: 174 PDI 176


>AE014134-1477|AAF52654.1|  317|Drosophila melanogaster CG17293-PA
           protein.
          Length = 317

 Score = 34.3 bits (75), Expect = 0.14
 Identities = 16/32 (50%), Positives = 21/32 (65%)
 Frame = +2

Query: 221 GHSHFISDVVLSSDGNYALSGSWDKTLRLWDL 316
           GH+  +  + +S   +  LSGS DKTLRLWDL
Sbjct: 107 GHTKKVISLCISPVEDTFLSGSLDKTLRLWDL 138


>AE013599-240|AAS64781.1|  528|Drosophila melanogaster CG9446-PC,
           isoform C protein.
          Length = 528

 Score = 34.3 bits (75), Expect = 0.14
 Identities = 27/123 (21%), Positives = 47/123 (38%), Gaps = 3/123 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           A G + +  P +K+         + GH G V  IA  P   ++I S S D  + VW++  
Sbjct: 54  AGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPD 113

Query: 182 D--ENNYGIPQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                    P   L  H   +  V+      N  L+   D  + +W++  G+     + H
Sbjct: 114 GGLSRTLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSH 173

Query: 353 TKV 361
             +
Sbjct: 174 PDI 176


>AE013599-239|AAM70835.1|  528|Drosophila melanogaster CG9446-PB,
           isoform B protein.
          Length = 528

 Score = 34.3 bits (75), Expect = 0.14
 Identities = 27/123 (21%), Positives = 47/123 (38%), Gaps = 3/123 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           A G + +  P +K+         + GH G V  IA  P   ++I S S D  + VW++  
Sbjct: 54  AGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPD 113

Query: 182 D--ENNYGIPQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                    P   L  H   +  V+      N  L+   D  + +W++  G+     + H
Sbjct: 114 GGLSRTLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSH 173

Query: 353 TKV 361
             +
Sbjct: 174 PDI 176


>AE013599-238|AAF57403.1|  528|Drosophila melanogaster CG9446-PA,
           isoform A protein.
          Length = 528

 Score = 34.3 bits (75), Expect = 0.14
 Identities = 27/123 (21%), Positives = 47/123 (38%), Gaps = 3/123 (2%)
 Frame = +2

Query: 2   ASGXSSLFKPFSKMSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTR 181
           A G + +  P +K+         + GH G V  IA  P   ++I S S D  + VW++  
Sbjct: 54  AGGGAFIVLPHNKVGRIAADHPLVGGHKGPVLDIAWCPHNDNVIASGSEDCVVKVWQIPD 113

Query: 182 D--ENNYGIPQKRLYGHSHFISDVVLSSDG-NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
                    P   L  H   +  V+      N  L+   D  + +W++  G+     + H
Sbjct: 114 GGLSRTLTEPVVDLVFHQRRVGLVLWHPSALNVLLTAGSDNQVVIWNVGTGEILVHIDSH 173

Query: 353 TKV 361
             +
Sbjct: 174 PDI 176


>M22567-1|AAB59247.1|  340|Drosophila melanogaster guanine
           nucleotide-binding regulatoryprotein protein.
          Length = 340

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 22/74 (29%), Positives = 39/74 (52%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A + K   ++L+   D    VW   + E + GI    L GH + +S + ++ +G  
Sbjct: 273 ITSVAFS-KSGRLLLAGYDDFNCNVWDTMKAERS-GI----LAGHDNRVSCLGVTENGMA 326

Query: 272 ALSGSWDKTLRLWD 313
             +GSWD  LR+W+
Sbjct: 327 VATGSWDSFLRVWN 340



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 23/91 (25%), Positives = 35/91 (38%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           + WV   A  P     +     D    ++ L   E N  +  + L GH  ++S      D
Sbjct: 97  SSWVMTCAYAPS-GSYVACGGLDNMCSIYNLKTREGNVRV-SRELPGHGGYLSCCRFLDD 154

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            N  ++ S D +  LWD+  G     F  HT
Sbjct: 155 -NQIVTSSGDMSCGLWDIETGLQVTSFLGHT 184



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 22/94 (23%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D +  +W +       G+      GH+  +  + 
Sbjct: 139 LPGHGGYLS--CCRFLDDNQIVTSSGDMSCGLWDIET-----GLQVTSFLGHTGDVMALS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+      +SG+ D + +LWD+  G   + F  H
Sbjct: 192 LAPQCKTFVSGACDASAKLWDIREGVCKQTFPGH 225


>AY058566-1|AAL13795.1|  340|Drosophila melanogaster LD25526p
           protein.
          Length = 340

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 22/74 (29%), Positives = 39/74 (52%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A + K   ++L+   D    VW   + E + GI    L GH + +S + ++ +G  
Sbjct: 273 ITSVAFS-KSGRLLLAGYDDFNCNVWDTMKAERS-GI----LAGHDNRVSCLGVTENGMA 326

Query: 272 ALSGSWDKTLRLWD 313
             +GSWD  LR+W+
Sbjct: 327 VATGSWDSFLRVWN 340



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 23/91 (25%), Positives = 35/91 (38%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           + WV   A  P     +     D    ++ L   E N  +  + L GH  ++S      D
Sbjct: 97  SSWVMTCAYAPS-GSYVACGGLDNMCSIYNLKTREGNVRV-SRELPGHGGYLSCCRFLDD 154

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            N  ++ S D +  LWD+  G     F  HT
Sbjct: 155 -NQIVTSSGDMSCGLWDIETGLQVTSFLGHT 184



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 22/94 (23%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D +  +W +       G+      GH+  +  + 
Sbjct: 139 LPGHGGYLS--CCRFLDDNQIVTSSGDMSCGLWDIET-----GLQVTSFLGHTGDVMALS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+      +SG+ D + +LWD+  G   + F  H
Sbjct: 192 LAPQCKTFVSGACDASAKLWDIREGVCKQTFPGH 225


>AE014298-2263|AAS65363.1|  340|Drosophila melanogaster CG10545-PF,
           isoform F protein.
          Length = 340

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 22/74 (29%), Positives = 39/74 (52%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A + K   ++L+   D    VW   + E + GI    L GH + +S + ++ +G  
Sbjct: 273 ITSVAFS-KSGRLLLAGYDDFNCNVWDTMKAERS-GI----LAGHDNRVSCLGVTENGMA 326

Query: 272 ALSGSWDKTLRLWD 313
             +GSWD  LR+W+
Sbjct: 327 VATGSWDSFLRVWN 340



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 23/91 (25%), Positives = 35/91 (38%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           + WV   A  P     +     D    ++ L   E N  +  + L GH  ++S      D
Sbjct: 97  SSWVMTCAYAPS-GSYVACGGLDNMCSIYNLKTREGNVRV-SRELPGHGGYLSCCRFLDD 154

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            N  ++ S D +  LWD+  G     F  HT
Sbjct: 155 -NQIVTSSGDMSCGLWDIETGLQVTSFLGHT 184



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 22/94 (23%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D +  +W +       G+      GH+  +  + 
Sbjct: 139 LPGHGGYLS--CCRFLDDNQIVTSSGDMSCGLWDIET-----GLQVTSFLGHTGDVMALS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+      +SG+ D + +LWD+  G   + F  H
Sbjct: 192 LAPQCKTFVSGACDASAKLWDIREGVCKQTFPGH 225


>AE014298-2262|AAS65362.1|  340|Drosophila melanogaster CG10545-PE,
           isoform E protein.
          Length = 340

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 22/74 (29%), Positives = 39/74 (52%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A + K   ++L+   D    VW   + E + GI    L GH + +S + ++ +G  
Sbjct: 273 ITSVAFS-KSGRLLLAGYDDFNCNVWDTMKAERS-GI----LAGHDNRVSCLGVTENGMA 326

Query: 272 ALSGSWDKTLRLWD 313
             +GSWD  LR+W+
Sbjct: 327 VATGSWDSFLRVWN 340



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 23/91 (25%), Positives = 35/91 (38%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           + WV   A  P     +     D    ++ L   E N  +  + L GH  ++S      D
Sbjct: 97  SSWVMTCAYAPS-GSYVACGGLDNMCSIYNLKTREGNVRV-SRELPGHGGYLSCCRFLDD 154

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            N  ++ S D +  LWD+  G     F  HT
Sbjct: 155 -NQIVTSSGDMSCGLWDIETGLQVTSFLGHT 184



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 22/94 (23%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D +  +W +       G+      GH+  +  + 
Sbjct: 139 LPGHGGYLS--CCRFLDDNQIVTSSGDMSCGLWDIET-----GLQVTSFLGHTGDVMALS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+      +SG+ D + +LWD+  G   + F  H
Sbjct: 192 LAPQCKTFVSGACDASAKLWDIREGVCKQTFPGH 225


>AE014298-2261|AAS65361.1|  340|Drosophila melanogaster CG10545-PD,
           isoform D protein.
          Length = 340

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 22/74 (29%), Positives = 39/74 (52%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A + K   ++L+   D    VW   + E + GI    L GH + +S + ++ +G  
Sbjct: 273 ITSVAFS-KSGRLLLAGYDDFNCNVWDTMKAERS-GI----LAGHDNRVSCLGVTENGMA 326

Query: 272 ALSGSWDKTLRLWD 313
             +GSWD  LR+W+
Sbjct: 327 VATGSWDSFLRVWN 340



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 23/91 (25%), Positives = 35/91 (38%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           + WV   A  P     +     D    ++ L   E N  +  + L GH  ++S      D
Sbjct: 97  SSWVMTCAYAPS-GSYVACGGLDNMCSIYNLKTREGNVRV-SRELPGHGGYLSCCRFLDD 154

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            N  ++ S D +  LWD+  G     F  HT
Sbjct: 155 -NQIVTSSGDMSCGLWDIETGLQVTSFLGHT 184



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 22/94 (23%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D +  +W +       G+      GH+  +  + 
Sbjct: 139 LPGHGGYLS--CCRFLDDNQIVTSSGDMSCGLWDIET-----GLQVTSFLGHTGDVMALS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+      +SG+ D + +LWD+  G   + F  H
Sbjct: 192 LAPQCKTFVSGACDASAKLWDIREGVCKQTFPGH 225


>AE014298-2260|AAS65360.1|  340|Drosophila melanogaster CG10545-PC,
           isoform C protein.
          Length = 340

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 22/74 (29%), Positives = 39/74 (52%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A + K   ++L+   D    VW   + E + GI    L GH + +S + ++ +G  
Sbjct: 273 ITSVAFS-KSGRLLLAGYDDFNCNVWDTMKAERS-GI----LAGHDNRVSCLGVTENGMA 326

Query: 272 ALSGSWDKTLRLWD 313
             +GSWD  LR+W+
Sbjct: 327 VATGSWDSFLRVWN 340



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 23/91 (25%), Positives = 35/91 (38%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           + WV   A  P     +     D    ++ L   E N  +  + L GH  ++S      D
Sbjct: 97  SSWVMTCAYAPS-GSYVACGGLDNMCSIYNLKTREGNVRV-SRELPGHGGYLSCCRFLDD 154

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            N  ++ S D +  LWD+  G     F  HT
Sbjct: 155 -NQIVTSSGDMSCGLWDIETGLQVTSFLGHT 184



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 22/94 (23%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D +  +W +       G+      GH+  +  + 
Sbjct: 139 LPGHGGYLS--CCRFLDDNQIVTSSGDMSCGLWDIET-----GLQVTSFLGHTGDVMALS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+      +SG+ D + +LWD+  G   + F  H
Sbjct: 192 LAPQCKTFVSGACDASAKLWDIREGVCKQTFPGH 225


>AE014298-2259|AAN09370.1|  340|Drosophila melanogaster CG10545-PB,
           isoform B protein.
          Length = 340

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 22/74 (29%), Positives = 39/74 (52%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A + K   ++L+   D    VW   + E + GI    L GH + +S + ++ +G  
Sbjct: 273 ITSVAFS-KSGRLLLAGYDDFNCNVWDTMKAERS-GI----LAGHDNRVSCLGVTENGMA 326

Query: 272 ALSGSWDKTLRLWD 313
             +GSWD  LR+W+
Sbjct: 327 VATGSWDSFLRVWN 340



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 23/91 (25%), Positives = 35/91 (38%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           + WV   A  P     +     D    ++ L   E N  +  + L GH  ++S      D
Sbjct: 97  SSWVMTCAYAPS-GSYVACGGLDNMCSIYNLKTREGNVRV-SRELPGHGGYLSCCRFLDD 154

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            N  ++ S D +  LWD+  G     F  HT
Sbjct: 155 -NQIVTSSGDMSCGLWDIETGLQVTSFLGHT 184



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 22/94 (23%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D +  +W +       G+      GH+  +  + 
Sbjct: 139 LPGHGGYLS--CCRFLDDNQIVTSSGDMSCGLWDIET-----GLQVTSFLGHTGDVMALS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+      +SG+ D + +LWD+  G   + F  H
Sbjct: 192 LAPQCKTFVSGACDASAKLWDIREGVCKQTFPGH 225


>AE014298-2258|AAF48530.1|  340|Drosophila melanogaster CG10545-PA,
           isoform A protein.
          Length = 340

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 22/74 (29%), Positives = 39/74 (52%)
 Frame = +2

Query: 92  VTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNY 271
           +T +A + K   ++L+   D    VW   + E + GI    L GH + +S + ++ +G  
Sbjct: 273 ITSVAFS-KSGRLLLAGYDDFNCNVWDTMKAERS-GI----LAGHDNRVSCLGVTENGMA 326

Query: 272 ALSGSWDKTLRLWD 313
             +GSWD  LR+W+
Sbjct: 327 VATGSWDSFLRVWN 340



 Score = 32.7 bits (71), Expect = 0.42
 Identities = 23/91 (25%), Positives = 35/91 (38%)
 Frame = +2

Query: 83  NGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSD 262
           + WV   A  P     +     D    ++ L   E N  +  + L GH  ++S      D
Sbjct: 97  SSWVMTCAYAPS-GSYVACGGLDNMCSIYNLKTREGNVRV-SRELPGHGGYLSCCRFLDD 154

Query: 263 GNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
            N  ++ S D +  LWD+  G     F  HT
Sbjct: 155 -NQIVTSSGDMSCGLWDIETGLQVTSFLGHT 184



 Score = 31.5 bits (68), Expect = 0.97
 Identities = 22/94 (23%), Positives = 42/94 (44%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH G+++         + I++SS D +  +W +       G+      GH+  +  + 
Sbjct: 139 LPGHGGYLS--CCRFLDDNQIVTSSGDMSCGLWDIET-----GLQVTSFLGHTGDVMALS 191

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           L+      +SG+ D + +LWD+  G   + F  H
Sbjct: 192 LAPQCKTFVSGACDASAKLWDIREGVCKQTFPGH 225


>AE014296-1503|AAF50379.1|  339|Drosophila melanogaster CG6486-PA
           protein.
          Length = 339

 Score = 33.9 bits (74), Expect = 0.18
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 7/91 (7%)
 Frame = +2

Query: 101 IATNPKYPDMILSSSRDKTLIVWKLTRDEN--NYGIPQKRLY---GHSHFISDVVLSSDG 265
           +A  P   D+  ++S D +L +W     E+  N   P++ L     H + +  +      
Sbjct: 76  VAWCPYAADIAATASGDGSLQIWCGLDGESASNQLTPKQPLICLQEHKNEVYSLDWGEKW 135

Query: 266 NY--ALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           NY   LSGSWD TL+LWD     +   F  H
Sbjct: 136 NYHTLLSGSWDCTLKLWDCNRQNSITTFVGH 166


>Y18278-2|CAC18800.1| 3347|Drosophila melanogaster AKAP550 protein.
          Length = 3347

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 9/90 (10%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIAT---NPKYPDMILSSSRDKTLIVWKLTR------DENNY 196
            +ET K+   + GH G VT +A    N      I S S D T+++W           E + 
Sbjct: 3111 TETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV 3170

Query: 197  GIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
              P+  L GH   ++ VV+S++    +SGS
Sbjct: 3171 PTPRATLTGHEQAVTSVVISAELGLVVSGS 3200


>Y18278-1|CAC18799.1| 3554|Drosophila melanogaster AKAP550 protein.
          Length = 3554

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 9/90 (10%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIAT---NPKYPDMILSSSRDKTLIVWKLTR------DENNY 196
            +ET K+   + GH G VT +A    N      I S S D T+++W           E + 
Sbjct: 3318 TETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV 3377

Query: 197  GIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
              P+  L GH   ++ VV+S++    +SGS
Sbjct: 3378 PTPRATLTGHEQAVTSVVISAELGLVVSGS 3407


>AY069717-1|AAL39862.1|  630|Drosophila melanogaster LP01609p
           protein.
          Length = 630

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH   V  ++ NP YP ++ S+S D T+ +W
Sbjct: 570 LAGHTKTVNCVSWNPVYPSLLASASDDATVRIW 602



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRL 307
           + S S DK + +W + R+E     P  +L GH+  ++ V  +    +   S S D T+R+
Sbjct: 547 VASGSEDKVVYIWHIKREE-----PLAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRI 601

Query: 308 W 310
           W
Sbjct: 602 W 602


>AY051596-1|AAK93020.1|  969|Drosophila melanogaster GH23814p protein.
          Length = 969

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 9/90 (10%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIAT---NPKYPDMILSSSRDKTLIVWKLTR------DENNY 196
            +ET K+   + GH G VT +A    N      I S S D T+++W           E + 
Sbjct: 733  TETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV 792

Query: 197  GIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
              P+  L GH   ++ VV+S++    +SGS
Sbjct: 793  PTPRATLTGHEQAVTSVVISAELGLVVSGS 822


>AE014298-711|AAN09135.1| 3522|Drosophila melanogaster CG6775-PB,
            isoform B protein.
          Length = 3522

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 9/90 (10%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIAT---NPKYPDMILSSSRDKTLIVWKLTR------DENNY 196
            +ET K+   + GH G VT +A    N      I S S D T+++W           E + 
Sbjct: 3286 TETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV 3345

Query: 197  GIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
              P+  L GH   ++ VV+S++    +SGS
Sbjct: 3346 PTPRATLTGHEQAVTSVVISAELGLVVSGS 3375


>AE014298-710|AAF46011.2| 3584|Drosophila melanogaster CG6775-PA,
            isoform A protein.
          Length = 3584

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 9/90 (10%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIAT---NPKYPDMILSSSRDKTLIVWKLTR------DENNY 196
            +ET K+   + GH G VT +A    N      I S S D T+++W           E + 
Sbjct: 3348 TETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV 3407

Query: 197  GIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
              P+  L GH   ++ VV+S++    +SGS
Sbjct: 3408 PTPRATLTGHEQAVTSVVISAELGLVVSGS 3437


>AE014298-705|ABI30968.1| 3719|Drosophila melanogaster CG6775-PC,
            isoform C protein.
          Length = 3719

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 27/90 (30%), Positives = 42/90 (46%), Gaps = 9/90 (10%)
 Frame = +2

Query: 44   SETLKLRGTLRGHNGWVTQIAT---NPKYPDMILSSSRDKTLIVWKLTR------DENNY 196
            +ET K+   + GH G VT +A    N      I S S D T+++W           E + 
Sbjct: 3483 TETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDV 3542

Query: 197  GIPQKRLYGHSHFISDVVLSSDGNYALSGS 286
              P+  L GH   ++ VV+S++    +SGS
Sbjct: 3543 PTPRATLTGHEQAVTSVVISAELGLVVSGS 3572


>AE014296-3563|AAN12175.1|  630|Drosophila melanogaster CG7611-PH,
           isoform H protein.
          Length = 630

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH   V  ++ NP YP ++ S+S D T+ +W
Sbjct: 570 LAGHTKTVNCVSWNPVYPSLLASASDDATVRIW 602



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRL 307
           + S S DK + +W + R+E     P  +L GH+  ++ V  +    +   S S D T+R+
Sbjct: 547 VASGSEDKVVYIWHIKREE-----PLAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRI 601

Query: 308 W 310
           W
Sbjct: 602 W 602


>AE014296-3562|AAN12174.1|  630|Drosophila melanogaster CG7611-PG,
           isoform G protein.
          Length = 630

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH   V  ++ NP YP ++ S+S D T+ +W
Sbjct: 570 LAGHTKTVNCVSWNPVYPSLLASASDDATVRIW 602



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRL 307
           + S S DK + +W + R+E     P  +L GH+  ++ V  +    +   S S D T+R+
Sbjct: 547 VASGSEDKVVYIWHIKREE-----PLAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRI 601

Query: 308 W 310
           W
Sbjct: 602 W 602


>AE014296-3561|AAN12173.1|  630|Drosophila melanogaster CG7611-PF,
           isoform F protein.
          Length = 630

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH   V  ++ NP YP ++ S+S D T+ +W
Sbjct: 570 LAGHTKTVNCVSWNPVYPSLLASASDDATVRIW 602



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRL 307
           + S S DK + +W + R+E     P  +L GH+  ++ V  +    +   S S D T+R+
Sbjct: 547 VASGSEDKVVYIWHIKREE-----PLAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRI 601

Query: 308 W 310
           W
Sbjct: 602 W 602


>AE014296-3560|AAN12172.1|  630|Drosophila melanogaster CG7611-PE,
           isoform E protein.
          Length = 630

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH   V  ++ NP YP ++ S+S D T+ +W
Sbjct: 570 LAGHTKTVNCVSWNPVYPSLLASASDDATVRIW 602



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRL 307
           + S S DK + +W + R+E     P  +L GH+  ++ V  +    +   S S D T+R+
Sbjct: 547 VASGSEDKVVYIWHIKREE-----PLAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRI 601

Query: 308 W 310
           W
Sbjct: 602 W 602


>AE014296-3559|AAG22181.1|  630|Drosophila melanogaster CG7611-PD,
           isoform D protein.
          Length = 630

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH   V  ++ NP YP ++ S+S D T+ +W
Sbjct: 570 LAGHTKTVNCVSWNPVYPSLLASASDDATVRIW 602



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRL 307
           + S S DK + +W + R+E     P  +L GH+  ++ V  +    +   S S D T+R+
Sbjct: 547 VASGSEDKVVYIWHIKREE-----PLAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRI 601

Query: 308 W 310
           W
Sbjct: 602 W 602


>AE014296-3558|AAG22182.2|  630|Drosophila melanogaster CG7611-PC,
           isoform C protein.
          Length = 630

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH   V  ++ NP YP ++ S+S D T+ +W
Sbjct: 570 LAGHTKTVNCVSWNPVYPSLLASASDDATVRIW 602



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRL 307
           + S S DK + +W + R+E     P  +L GH+  ++ V  +    +   S S D T+R+
Sbjct: 547 VASGSEDKVVYIWHIKREE-----PLAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRI 601

Query: 308 W 310
           W
Sbjct: 602 W 602


>AE014296-3557|AAG22180.1|  630|Drosophila melanogaster CG7611-PB,
           isoform B protein.
          Length = 630

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH   V  ++ NP YP ++ S+S D T+ +W
Sbjct: 570 LAGHTKTVNCVSWNPVYPSLLASASDDATVRIW 602



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRL 307
           + S S DK + +W + R+E     P  +L GH+  ++ V  +    +   S S D T+R+
Sbjct: 547 VASGSEDKVVYIWHIKREE-----PLAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRI 601

Query: 308 W 310
           W
Sbjct: 602 W 602


>AE014296-3556|AAF51739.2|  630|Drosophila melanogaster CG7611-PA,
           isoform A protein.
          Length = 630

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVW 169
           L GH   V  ++ NP YP ++ S+S D T+ +W
Sbjct: 570 LAGHTKTVNCVSWNPVYPSLLASASDDATVRIW 602



 Score = 29.9 bits (64), Expect = 2.9
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSS-DGNYALSGSWDKTLRL 307
           + S S DK + +W + R+E     P  +L GH+  ++ V  +    +   S S D T+R+
Sbjct: 547 VASGSEDKVVYIWHIKREE-----PLAKLAGHTKTVNCVSWNPVYPSLLASASDDATVRI 601

Query: 308 W 310
           W
Sbjct: 602 W 602


>AE014296-796|AAF47865.2|  878|Drosophila melanogaster CG1332-PA
           protein.
          Length = 878

 Score = 33.5 bits (73), Expect = 0.24
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
 Frame = +2

Query: 185 ENNYGI-PQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTR 337
           +N+Y   P   LYGH   IS V + ++ +  +SGS D T+ ++ L  G+  R
Sbjct: 691 QNSYSPKPLTVLYGHDDAISSVAIYTELDLVVSGSLDGTVNVYTLQEGQFVR 742



 Score = 29.5 bits (63), Expect = 3.9
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 4/52 (7%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYG----IPQKRLYGHSHFISDVVLSSDGNYA 274
           +++ SRD T IVW +  ++   G    IP   L G SH  +   L++  +Y+
Sbjct: 644 LVTGSRDCTCIVWSIQTNQQGGGSTNNIPVHALTGQSHLQAITQLNTQNSYS 695


>U90930-1|AAB53431.1|  326|Drosophila melanogaster TRIP-1 homolog
           protein.
          Length = 326

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL--Y-GHSHFIS 241
           L+GH   +TQI  N +  D++ S S+D+   VW        Y +  +RL  Y GH   + 
Sbjct: 6   LQGHERSITQIKYN-REGDLLFSCSKDQKPNVW--------YSLNGERLGTYDGHQGAVW 56

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            + +  +    ++G+ D T ++WD+  G
Sbjct: 57  CLDVDWESRKLITGAGDMTAKIWDVEYG 84


>BT016079-1|AAV36964.1|  922|Drosophila melanogaster LD47749p
           protein.
          Length = 922

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 10/45 (22%), Positives = 25/45 (55%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++  GH+  ++D+  S D  + ++ + D T+++WD+ +      F
Sbjct: 577 RKFVGHTAKLNDLTFSPDSRWLITAAMDSTIKVWDIPSSYMVDHF 621


>AY118891-1|AAM50751.1| 1508|Drosophila melanogaster LD01189p
           protein.
          Length = 1508

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 17/62 (27%), Positives = 32/62 (51%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + +S  DKTL V+    +E        R+YGHS  ++ +  ++D  + +S S D  + +W
Sbjct: 662 VATSCTDKTLAVYDYYSNEC-----MARMYGHSELVTGLKFTNDCRHLISASGDGCIFIW 716

Query: 311 DL 316
            +
Sbjct: 717 QV 718


>AY118759-1|AAM50619.1|  656|Drosophila melanogaster GH09073p
           protein.
          Length = 656

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           H+  V  +A NP+  +M++++S D T+ VW+       + IP
Sbjct: 602 HSDVVNSVAFNPRDSEMLVTTSDDYTIKVWRSRAKAKEFNIP 643


>AY118527-1|AAM49896.1|  326|Drosophila melanogaster LD24026p
           protein.
          Length = 326

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL--Y-GHSHFIS 241
           L+GH   +TQI  N +  D++ S S+D+   VW        Y +  +RL  Y GH   + 
Sbjct: 6   LQGHERSITQIKYN-REGDLLFSCSKDQKPNVW--------YSLNGERLGTYDGHQGAVW 56

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            + +  +    ++G+ D T ++WD+  G
Sbjct: 57  CLDVDWESRKLITGAGDMTAKIWDVEYG 84


>AY058590-1|AAL13819.1|  446|Drosophila melanogaster LD28275p
           protein.
          Length = 446

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 18/84 (21%), Positives = 34/84 (40%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V+    +PK    + + + D  + +W L        I  +    H  F+  + 
Sbjct: 62  LSGHRDGVSCFGKHPKQLSTLATGAYDGEVRIWDLANR-----ISSRNFVAHDGFVRGIA 116

Query: 251 LSSDGNYALSGSWDKTLRLWDLAA 322
            + +G    +   DKT+++W   A
Sbjct: 117 YTQNGGRIFTVGDDKTIKVWKAEA 140



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 3/97 (3%)
 Frame = +2

Query: 47  ETLKLRGTLR---GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +T KL+  L+    H   VT +  +P   + + S+S DKT+ ++      +      KR+
Sbjct: 267 DTRKLQTPLKVHFDHVSAVTDVDYSPTGKEFV-SASYDKTIRIYNAHHSHSRDIYHTKRM 325

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
               H +  V  S D  Y  SGS +  +R+W   A +
Sbjct: 326 ---QHVVC-VAWSLDNRYVFSGSDEMNVRMWKANASE 358



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 176 TRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           T D      P K  + H   ++DV  S  G   +S S+DKT+R+++
Sbjct: 265 TFDTRKLQTPLKVHFDHVSAVTDVDYSPTGKEFVSASYDKTIRIYN 310


>AY052114-1|AAK93538.1|  922|Drosophila melanogaster SD06427p
           protein.
          Length = 922

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 10/45 (22%), Positives = 25/45 (55%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++  GH+  ++D+  S D  + ++ + D T+++WD+ +      F
Sbjct: 577 RKFVGHTAKLNDLTFSPDSRWLITAAMDSTIKVWDIPSSYMVDHF 621


>AY052025-1|AAK93449.1| 1183|Drosophila melanogaster LD47622p
           protein.
          Length = 1183

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 17/62 (27%), Positives = 32/62 (51%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + +S  DKTL V+    +E        R+YGHS  ++ +  ++D  + +S S D  + +W
Sbjct: 337 VATSCTDKTLAVYDYYSNEC-----MARMYGHSELVTGLKFTNDCRHLISASGDGCIFIW 391

Query: 311 DL 316
            +
Sbjct: 392 QV 393


>AE014297-1680|AAF54941.1|  922|Drosophila melanogaster CG9799-PA
           protein.
          Length = 922

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 10/45 (22%), Positives = 25/45 (55%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
           ++  GH+  ++D+  S D  + ++ + D T+++WD+ +      F
Sbjct: 577 RKFVGHTAKLNDLTFSPDSRWLITAAMDSTIKVWDIPSSYMVDHF 621


>AE014296-2508|AAF49638.2|  446|Drosophila melanogaster CG7275-PA
           protein.
          Length = 446

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 18/84 (21%), Positives = 34/84 (40%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           L GH   V+    +PK    + + + D  + +W L        I  +    H  F+  + 
Sbjct: 62  LSGHRDGVSCFGKHPKQLSTLATGAYDGEVRIWDLANR-----ISSRNFVAHDGFVRGIA 116

Query: 251 LSSDGNYALSGSWDKTLRLWDLAA 322
            + +G    +   DKT+++W   A
Sbjct: 117 YTQNGGRIFTVGDDKTIKVWKAEA 140



 Score = 30.7 bits (66), Expect = 1.7
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 3/97 (3%)
 Frame = +2

Query: 47  ETLKLRGTLR---GHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL 217
           +T KL+  L+    H   VT +  +P   + + S+S DKT+ ++      +      KR+
Sbjct: 267 DTRKLQTPLKVHFDHVSAVTDVDYSPTGKEFV-SASYDKTIRIYNAHHSHSRDIYHTKRM 325

Query: 218 YGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
               H +  V  S D  Y  SGS +  +R+W   A +
Sbjct: 326 ---QHVVC-VAWSLDNRYVFSGSDEMNVRMWKANASE 358



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = +2

Query: 176 TRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWD 313
           T D      P K  + H   ++DV  S  G   +S S+DKT+R+++
Sbjct: 265 TFDTRKLQTPLKVHFDHVSAVTDVDYSPTGKEFVSASYDKTIRIYN 310


>AE014134-1040|AAF52336.2|  656|Drosophila melanogaster CG9144-PA
           protein.
          Length = 656

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 13/42 (30%), Positives = 24/42 (57%)
 Frame = +2

Query: 80  HNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIP 205
           H+  V  +A NP+  +M++++S D T+ VW+       + IP
Sbjct: 602 HSDVVNSVAFNPRDSEMLVTTSDDYTIKVWRSRAKAKEFNIP 643


>AE014134-821|AAF52183.1|  326|Drosophila melanogaster CG8882-PA
           protein.
          Length = 326

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 3/88 (3%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRL--Y-GHSHFIS 241
           L+GH   +TQI  N +  D++ S S+D+   VW        Y +  +RL  Y GH   + 
Sbjct: 6   LQGHERSITQIKYN-REGDLLFSCSKDQKPNVW--------YSLNGERLGTYDGHQGAVW 56

Query: 242 DVVLSSDGNYALSGSWDKTLRLWDLAAG 325
            + +  +    ++G+ D T ++WD+  G
Sbjct: 57  CLDVDWESRKLITGAGDMTAKIWDVEYG 84


>AE014134-313|ABI31283.1| 1504|Drosophila melanogaster CG7337-PB,
           isoform B protein.
          Length = 1504

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 17/62 (27%), Positives = 32/62 (51%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + +S  DKTL V+    +E        R+YGHS  ++ +  ++D  + +S S D  + +W
Sbjct: 658 VATSCTDKTLAVYDYYSNEC-----MARMYGHSELVTGLKFTNDCRHLISASGDGCIFIW 712

Query: 311 DL 316
            +
Sbjct: 713 QV 714


>AE014134-312|ABI31282.1| 2347|Drosophila melanogaster CG7337-PC,
           isoform C protein.
          Length = 2347

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 17/62 (27%), Positives = 32/62 (51%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + +S  DKTL V+    +E        R+YGHS  ++ +  ++D  + +S S D  + +W
Sbjct: 658 VATSCTDKTLAVYDYYSNEC-----MARMYGHSELVTGLKFTNDCRHLISASGDGCIFIW 712

Query: 311 DL 316
            +
Sbjct: 713 QV 714


>AE014134-311|AAF51327.2| 1508|Drosophila melanogaster CG7337-PA,
           isoform A protein.
          Length = 1508

 Score = 33.1 bits (72), Expect = 0.32
 Identities = 17/62 (27%), Positives = 32/62 (51%)
 Frame = +2

Query: 131 ILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLW 310
           + +S  DKTL V+    +E        R+YGHS  ++ +  ++D  + +S S D  + +W
Sbjct: 662 VATSCTDKTLAVYDYYSNEC-----MARMYGHSELVTGLKFTNDCRHLISASGDGCIFIW 716

Query: 311 DL 316
            +
Sbjct: 717 QV 718


>AY118526-1|AAM49895.1|  323|Drosophila melanogaster LD23540p
           protein.
          Length = 323

 Score = 32.7 bits (71), Expect = 0.42
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           N  L+GSWD T++LWD+   +    FE +
Sbjct: 108 NGILTGSWDNTVKLWDMREKRCVGTFEQN 136



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +2

Query: 236 ISDVVLSSDGN-YALSGSWDKTLRLWDLAAGKTTRRF 343
           IS V      N Y  + SWD TLR +D+ A +  ++F
Sbjct: 16  ISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQKF 52


>AY071120-1|AAL48742.1|  489|Drosophila melanogaster RE17089p
           protein.
          Length = 489

 Score = 32.7 bits (71), Expect = 0.42
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 1/77 (1%)
 Frame = +2

Query: 116 KYPDMILSSSRDKTLIVWK-LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           KY  ++     D  +++W  LTR     GI  K +  H H +  +  + +G+  LS S D
Sbjct: 34  KYGTLLAVGCNDGRIVIWDFLTR-----GIA-KIISAHVHPVCSLSWTRNGHKLLSASTD 87

Query: 293 KTLRLWDLAAGKTTRRF 343
             + +WD+  G+   ++
Sbjct: 88  NNVCIWDVLTGELEHKY 104


>AF160906-1|AAD46846.1|  505|Drosophila melanogaster BcDNA.LD02793
           protein.
          Length = 505

 Score = 32.7 bits (71), Expect = 0.42
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 2/74 (2%)
 Frame = +2

Query: 101 IATNPKYPDMIL--SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYA 274
           + T   +PD ++  + + D  + +W L    N    P     GH+  IS +  S +G Y 
Sbjct: 353 LTTAQFHPDGLIFGTGTVDSQVKIWDLKEQSNVANFP-----GHTGPISAISFSENGYYL 407

Query: 275 LSGSWDKTLRLWDL 316
            + + D  ++LWDL
Sbjct: 408 ATAADDACVKLWDL 421



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 26/95 (27%), Positives = 41/95 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LR H G VT ++ +P   D +LS+S DK    W  + D     +  K +      ++   
Sbjct: 303 LRCHEGPVTGLSLHPT-GDYLLSTSSDKH---WAFS-DIRTGRLLTKVIDTAEVGLTTAQ 357

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              DG    +G+ D  +++WDL        F  HT
Sbjct: 358 FHPDGLIFGTGTVDSQVKIWDLKEQSNVANFPGHT 392


>AF088846-1|AAD44035.1|  327|Drosophila melanogaster mitotic
           checkpoint control protein protein.
          Length = 327

 Score = 32.7 bits (71), Expect = 0.42
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           N  L+GSWD T++LWD+   +    FE +
Sbjct: 108 NGILTGSWDNTVKLWDMREKRCVGTFEQN 136



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +2

Query: 236 ISDVVLSSDGN-YALSGSWDKTLRLWDLAAGKTTRRF 343
           IS V      N Y  + SWD TLR +D+ A +  ++F
Sbjct: 16  ISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQKF 52


>AF075594-1|AAD13398.1|  327|Drosophila melanogaster mitotic
           checkpoint control proteinBub3 protein.
          Length = 327

 Score = 32.7 bits (71), Expect = 0.42
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           N  L+GSWD T++LWD+   +    FE +
Sbjct: 108 NGILTGSWDNTVKLWDMREKRCVGTFEQN 136



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +2

Query: 236 ISDVVLSSDGN-YALSGSWDKTLRLWDLAAGKTTRRF 343
           IS V      N Y  + SWD TLR +D+ A +  ++F
Sbjct: 16  ISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQKF 52


>AE014297-4409|AAF56914.1|  326|Drosophila melanogaster CG7581-PA
           protein.
          Length = 326

 Score = 32.7 bits (71), Expect = 0.42
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           N  L+GSWD T++LWD+   +    FE +
Sbjct: 108 NGILTGSWDNTVKLWDMREKRCVGTFEQN 136



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +2

Query: 236 ISDVVLSSDGN-YALSGSWDKTLRLWDLAAGKTTRRF 343
           IS V      N Y  + SWD TLR +D+ A +  ++F
Sbjct: 16  ISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQKF 52


>AE014296-3329|AAF51573.2|  489|Drosophila melanogaster CG5585-PA
           protein.
          Length = 489

 Score = 32.7 bits (71), Expect = 0.42
 Identities = 20/77 (25%), Positives = 37/77 (48%), Gaps = 1/77 (1%)
 Frame = +2

Query: 116 KYPDMILSSSRDKTLIVWK-LTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWD 292
           KY  ++     D  +++W  LTR     GI  K +  H H +  +  + +G+  LS S D
Sbjct: 34  KYGTLLAVGCNDGRIVIWDFLTR-----GIA-KIISAHVHPVCSLSWTRNGHKLLSASTD 87

Query: 293 KTLRLWDLAAGKTTRRF 343
             + +WD+  G+   ++
Sbjct: 88  NNVCIWDVLTGELEHKY 104


>AE013599-2704|AAF57684.1|  505|Drosophila melanogaster CG5519-PA
           protein.
          Length = 505

 Score = 32.7 bits (71), Expect = 0.42
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 2/74 (2%)
 Frame = +2

Query: 101 IATNPKYPDMIL--SSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYA 274
           + T   +PD ++  + + D  + +W L    N    P     GH+  IS +  S +G Y 
Sbjct: 353 LTTAQFHPDGLIFGTGTVDSQVKIWDLKEQSNVANFP-----GHTGPISAISFSENGYYL 407

Query: 275 LSGSWDKTLRLWDL 316
            + + D  ++LWDL
Sbjct: 408 ATAADDACVKLWDL 421



 Score = 31.1 bits (67), Expect = 1.3
 Identities = 26/95 (27%), Positives = 41/95 (43%)
 Frame = +2

Query: 71  LRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVV 250
           LR H G VT ++ +P   D +LS+S DK    W  + D     +  K +      ++   
Sbjct: 303 LRCHEGPVTGLSLHPT-GDYLLSTSSDKH---WAFS-DIRTGRLLTKVIDTAEVGLTTAQ 357

Query: 251 LSSDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHT 355
              DG    +G+ D  +++WDL        F  HT
Sbjct: 358 FHPDGLIFGTGTVDSQVKIWDLKEQSNVANFPGHT 392


>AY061340-1|AAL28888.1|  608|Drosophila melanogaster LD27045p
           protein.
          Length = 608

 Score = 32.3 bits (70), Expect = 0.55
 Identities = 28/104 (26%), Positives = 43/104 (41%), Gaps = 3/104 (2%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK--- 211
           MSET    G + G +  +      P  P  I++ S D T+ V++        G P K   
Sbjct: 138 MSETGTSVGEISGQSKSINSADFRPARPFRIVTGSEDNTIAVFE--------GPPFKFKM 189

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
               HS F+  V  S DG +  S  +D  + L+D  + +    F
Sbjct: 190 TKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEF 233


>AF106679-1|AAD21971.1|  326|Drosophila melanogaster WD-40 repeat
           protein protein.
          Length = 326

 Score = 32.3 bits (70), Expect = 0.55
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 266 NYALSGSWDKTLRLWDLAAGKTTRRFEDH 352
           N  L+GSWD T++LWD+   +    FE +
Sbjct: 108 NGILTGSWDNTVKLWDMREKRCLGTFEQN 136



 Score = 28.3 bits (60), Expect = 9.0
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +2

Query: 236 ISDVVLSSDGN-YALSGSWDKTLRLWDLAAGKTTRRF 343
           IS V      N Y  + SWD TLR +D+ A +  ++F
Sbjct: 16  ISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQKF 52


>AE014296-2271|AAN11835.1|  604|Drosophila melanogaster CG10724-PB,
           isoform B protein.
          Length = 604

 Score = 32.3 bits (70), Expect = 0.55
 Identities = 28/104 (26%), Positives = 43/104 (41%), Gaps = 3/104 (2%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK--- 211
           MSET    G + G +  +      P  P  I++ S D T+ V++        G P K   
Sbjct: 134 MSETGTSVGEISGQSKSINSADFRPARPFRIVTGSEDNTIAVFE--------GPPFKFKM 185

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
               HS F+  V  S DG +  S  +D  + L+D  + +    F
Sbjct: 186 TKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEF 229


>AE014296-2270|AAF49822.1|  608|Drosophila melanogaster CG10724-PA,
           isoform A protein.
          Length = 608

 Score = 32.3 bits (70), Expect = 0.55
 Identities = 28/104 (26%), Positives = 43/104 (41%), Gaps = 3/104 (2%)
 Frame = +2

Query: 41  MSETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQK--- 211
           MSET    G + G +  +      P  P  I++ S D T+ V++        G P K   
Sbjct: 138 MSETGTSVGEISGQSKSINSADFRPARPFRIVTGSEDNTIAVFE--------GPPFKFKM 189

Query: 212 RLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGKTTRRF 343
               HS F+  V  S DG +  S  +D  + L+D  + +    F
Sbjct: 190 TKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSELVGEF 233


>AE014134-2026|AAS64677.1|  969|Drosophila melanogaster CG4705-PB,
           isoform B protein.
          Length = 969

 Score = 32.3 bits (70), Expect = 0.55
 Identities = 23/86 (26%), Positives = 39/86 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +LRGH   VT I  + K P++++S S D    +W L R+     +    +       + V
Sbjct: 124 SLRGHTRTVTDIDWHGKDPNLLVSCSIDTFSHIWDL-REPRKPALSLNAVCMSG--ATQV 180

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAG 325
             +      L+ + D  LR+WD+  G
Sbjct: 181 GFNRVSGNLLAAAHDGDLRIWDIRKG 206


>AE014134-2025|AAF53065.2|  989|Drosophila melanogaster CG4705-PA,
           isoform A protein.
          Length = 989

 Score = 32.3 bits (70), Expect = 0.55
 Identities = 23/86 (26%), Positives = 39/86 (45%)
 Frame = +2

Query: 68  TLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDV 247
           +LRGH   VT I  + K P++++S S D    +W L R+     +    +       + V
Sbjct: 124 SLRGHTRTVTDIDWHGKDPNLLVSCSIDTFSHIWDL-REPRKPALSLNAVCMSG--ATQV 180

Query: 248 VLSSDGNYALSGSWDKTLRLWDLAAG 325
             +      L+ + D  LR+WD+  G
Sbjct: 181 GFNRVSGNLLAAAHDGDLRIWDIRKG 206


>AY075228-1|AAL68095.1|  511|Drosophila melanogaster AT18160p
           protein.
          Length = 511

 Score = 31.9 bits (69), Expect = 0.73
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 2/69 (2%)
 Frame = +2

Query: 116 KYPDMILSSSRDKTLIVWKLTRDENNYGIPQK--RLYGHSHFISDVVLSSDGNYALSGSW 289
           K P++I++   D  L V+ L     +  + +      GH   I+ +   +DG + LS S 
Sbjct: 278 KDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVASFIGHYDGITYIDSRNDGYHVLSNSK 337

Query: 290 DKTLRLWDL 316
           D+++++WD+
Sbjct: 338 DQSIKIWDI 346


>AY051986-1|AAK93410.1|  613|Drosophila melanogaster LD45447p
           protein.
          Length = 613

 Score = 31.9 bits (69), Expect = 0.73
 Identities = 15/63 (23%), Positives = 32/63 (50%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           +  + S D T+ +W L   +    +    L+GHS+++ ++  SS     +S  +D ++  
Sbjct: 104 LFATGSDDFTVALWDLRNMKQKLRV----LHGHSNWVKNIEYSSKDKLLVSSGFDGSIFT 159

Query: 308 WDL 316
           WD+
Sbjct: 160 WDI 162


>AE014297-4270|AAF56817.1|  621|Drosophila melanogaster CG1523-PA
           protein.
          Length = 621

 Score = 31.9 bits (69), Expect = 0.73
 Identities = 15/63 (23%), Positives = 32/63 (50%)
 Frame = +2

Query: 128 MILSSSRDKTLIVWKLTRDENNYGIPQKRLYGHSHFISDVVLSSDGNYALSGSWDKTLRL 307
           +  + S D T+ +W L   +    +    L+GHS+++ ++  SS     +S  +D ++  
Sbjct: 104 LFATGSDDFTVALWDLRNMKQKLRV----LHGHSNWVKNIEYSSKDKLLVSSGFDGSIFT 159

Query: 308 WDL 316
           WD+
Sbjct: 160 WDI 162


>AE014297-3524|AAF56278.2| 2232|Drosophila melanogaster CG31132-PA
           protein.
          Length = 2232

 Score = 31.9 bits (69), Expect = 0.73
 Identities = 13/44 (29%), Positives = 25/44 (56%)
 Frame = +2

Query: 44  SETLKLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKL 175
           S++ KL   LRGH   +  + +NP+   ++LS+  D  + +W +
Sbjct: 454 SKSAKLHRVLRGHKDELYVLESNPRDEHVLLSAGHDGQVFLWDI 497



 Score = 29.1 bits (62), Expect = 5.1
 Identities = 11/40 (27%), Positives = 21/40 (52%)
 Frame = +2

Query: 209 KRLYGHSHFISDVVLSSDGNYALSGSWDKTLRLWDLAAGK 328
           +R  GH   +  V+    G Y ++G+ D  +++W  A G+
Sbjct: 177 RRTVGHLSSVYCVLFDRTGRYIITGADDLLIKIWSAADGR 216


>AE013599-3043|AAM68392.1|  511|Drosophila melanogaster CG9945-PB,
           isoform B protein.
          Length = 511

 Score = 31.9 bits (69), Expect = 0.73
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 2/69 (2%)
 Frame = +2

Query: 116 KYPDMILSSSRDKTLIVWKLTRDENNYGIPQK--RLYGHSHFISDVVLSSDGNYALSGSW 289
           K P++I++   D  L V+ L     +  + +      GH   I+ +   +DG + LS S 
Sbjct: 278 KDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVASFIGHYDGITYIDSRNDGYHVLSNSK 337

Query: 290 DKTLRLWDL 316
           D+++++WD+
Sbjct: 338 DQSIKIWDI 346


>AE013599-3042|AAF57446.2|  511|Drosophila melanogaster CG9945-PA,
           isoform A protein.
          Length = 511

 Score = 31.9 bits (69), Expect = 0.73
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 2/69 (2%)
 Frame = +2

Query: 116 KYPDMILSSSRDKTLIVWKLTRDENNYGIPQK--RLYGHSHFISDVVLSSDGNYALSGSW 289
           K P++I++   D  L V+ L     +  + +      GH   I+ +   +DG + LS S 
Sbjct: 278 KDPNVIIAGCDDGLLKVYDLRTTFRSRDLSKSVASFIGHYDGITYIDSRNDGYHVLSNSK 337

Query: 290 DKTLRLWDL 316
           D+++++WD+
Sbjct: 338 DQSIKIWDI 346


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,630,414
Number of Sequences: 53049
Number of extensions: 551505
Number of successful extensions: 2779
Number of sequences better than 10.0: 335
Number of HSP's better than 10.0 without gapping: 1816
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2531
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2600432100
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -