SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A08
         (614 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U15220-1|AAA61796.1| 1051|Drosophila melanogaster gp150 protein ...    83   3e-16
BT015195-1|AAT94424.1| 1076|Drosophila melanogaster RE72245p pro...    83   3e-16
BT011025-1|AAR30185.1| 1051|Drosophila melanogaster RE46351p pro...    83   3e-16
AY029705-1|AAK39644.1| 1051|Drosophila melanogaster leucine rich...    83   3e-16
AE013599-3379|AAG22195.1| 1051|Drosophila melanogaster CG5820-PC...    83   3e-16
AE013599-3378|AAM68222.1| 1051|Drosophila melanogaster CG5820-PB...    83   3e-16
AE013599-3377|AAF46831.1| 1051|Drosophila melanogaster CG5820-PA...    83   3e-16
AE013599-3376|AAM68221.1| 1076|Drosophila melanogaster CG5820-PD...    83   3e-16
AF247768-1|AAF86228.1|  809|Drosophila melanogaster Toll-4 protein.    31   1.6  
AE014134-1604|AAF52747.3| 1125|Drosophila melanogaster CG18241-P...    31   1.6  

>U15220-1|AAA61796.1| 1051|Drosophila melanogaster gp150 protein
           protein.
          Length = 1051

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/77 (49%), Positives = 50/77 (64%)
 Frame = +1

Query: 382 LRGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLXDFMFXKLGLHXVATVKIVNS 561
           +  Y  A CS L++G QKFG DI DLVV N  P+YPI +    F  LGL  VA++KI N 
Sbjct: 243 VNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQNLGLKNVASIKIANC 302

Query: 562 TIGYIAPNAFHGVHDLY 612
           T+ Y+   AFHG+++LY
Sbjct: 303 TLEYLHAEAFHGLNELY 319



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 273 DADNLLDQYEDYEPAEYQEVLYNEDRPCPRDCICS 377
           D D+  D   D    + ++V+++ED PCPR C C+
Sbjct: 206 DDDDDEDDAADDLLTDDEQVVFSEDVPCPRFCQCA 240


>BT015195-1|AAT94424.1| 1076|Drosophila melanogaster RE72245p
           protein.
          Length = 1076

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/77 (49%), Positives = 50/77 (64%)
 Frame = +1

Query: 382 LRGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLXDFMFXKLGLHXVATVKIVNS 561
           +  Y  A CS L++G QKFG DI DLVV N  P+YPI +    F  LGL  VA++KI N 
Sbjct: 268 VNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQNLGLKNVASIKIANC 327

Query: 562 TIGYIAPNAFHGVHDLY 612
           T+ Y+   AFHG+++LY
Sbjct: 328 TLEYLHAEAFHGLNELY 344



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 273 DADNLLDQYEDYEPAEYQEVLYNEDRPCPRDCICS 377
           D D+  D   D    + ++V+++ED PCPR C C+
Sbjct: 231 DDDDDEDDAADDLLTDDEQVVFSEDVPCPRFCQCA 265


>BT011025-1|AAR30185.1| 1051|Drosophila melanogaster RE46351p
           protein.
          Length = 1051

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/77 (49%), Positives = 50/77 (64%)
 Frame = +1

Query: 382 LRGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLXDFMFXKLGLHXVATVKIVNS 561
           +  Y  A CS L++G QKFG DI DLVV N  P+YPI +    F  LGL  VA++KI N 
Sbjct: 243 VNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQNLGLKNVASIKIANC 302

Query: 562 TIGYIAPNAFHGVHDLY 612
           T+ Y+   AFHG+++LY
Sbjct: 303 TLEYLHAEAFHGLNELY 319



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 273 DADNLLDQYEDYEPAEYQEVLYNEDRPCPRDCICS 377
           D D+  D   D    + ++V+++ED PCPR C C+
Sbjct: 206 DDDDDEDDAADDLLTDDEQVVFSEDVPCPRFCQCA 240


>AY029705-1|AAK39644.1| 1051|Drosophila melanogaster leucine rich
           repeat protein GP150 protein.
          Length = 1051

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/77 (49%), Positives = 50/77 (64%)
 Frame = +1

Query: 382 LRGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLXDFMFXKLGLHXVATVKIVNS 561
           +  Y  A CS L++G QKFG DI DLVV N  P+YPI +    F  LGL  VA++KI N 
Sbjct: 243 VNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQNLGLKNVASIKIANC 302

Query: 562 TIGYIAPNAFHGVHDLY 612
           T+ Y+   AFHG+++LY
Sbjct: 303 TLEYLHAEAFHGLNELY 319



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 273 DADNLLDQYEDYEPAEYQEVLYNEDRPCPRDCICS 377
           D D+  D   D    + ++V+++ED PCPR C C+
Sbjct: 206 DDDDDEDDAADDLLTDDEQVVFSEDVPCPRFCQCA 240


>AE013599-3379|AAG22195.1| 1051|Drosophila melanogaster CG5820-PC,
           isoform C protein.
          Length = 1051

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/77 (49%), Positives = 50/77 (64%)
 Frame = +1

Query: 382 LRGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLXDFMFXKLGLHXVATVKIVNS 561
           +  Y  A CS L++G QKFG DI DLVV N  P+YPI +    F  LGL  VA++KI N 
Sbjct: 243 VNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQNLGLKNVASIKIANC 302

Query: 562 TIGYIAPNAFHGVHDLY 612
           T+ Y+   AFHG+++LY
Sbjct: 303 TLEYLHAEAFHGLNELY 319



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 273 DADNLLDQYEDYEPAEYQEVLYNEDRPCPRDCICS 377
           D D+  D   D    + ++V+++ED PCPR C C+
Sbjct: 206 DDDDDEDDAADDLLTDDEQVVFSEDVPCPRFCQCA 240


>AE013599-3378|AAM68222.1| 1051|Drosophila melanogaster CG5820-PB,
           isoform B protein.
          Length = 1051

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/77 (49%), Positives = 50/77 (64%)
 Frame = +1

Query: 382 LRGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLXDFMFXKLGLHXVATVKIVNS 561
           +  Y  A CS L++G QKFG DI DLVV N  P+YPI +    F  LGL  VA++KI N 
Sbjct: 243 VNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQNLGLKNVASIKIANC 302

Query: 562 TIGYIAPNAFHGVHDLY 612
           T+ Y+   AFHG+++LY
Sbjct: 303 TLEYLHAEAFHGLNELY 319



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 273 DADNLLDQYEDYEPAEYQEVLYNEDRPCPRDCICS 377
           D D+  D   D    + ++V+++ED PCPR C C+
Sbjct: 206 DDDDDEDDAADDLLTDDEQVVFSEDVPCPRFCQCA 240


>AE013599-3377|AAF46831.1| 1051|Drosophila melanogaster CG5820-PA,
           isoform A protein.
          Length = 1051

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/77 (49%), Positives = 50/77 (64%)
 Frame = +1

Query: 382 LRGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLXDFMFXKLGLHXVATVKIVNS 561
           +  Y  A CS L++G QKFG DI DLVV N  P+YPI +    F  LGL  VA++KI N 
Sbjct: 243 VNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQNLGLKNVASIKIANC 302

Query: 562 TIGYIAPNAFHGVHDLY 612
           T+ Y+   AFHG+++LY
Sbjct: 303 TLEYLHAEAFHGLNELY 319



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 273 DADNLLDQYEDYEPAEYQEVLYNEDRPCPRDCICS 377
           D D+  D   D    + ++V+++ED PCPR C C+
Sbjct: 206 DDDDDEDDAADDLLTDDEQVVFSEDVPCPRFCQCA 240


>AE013599-3376|AAM68221.1| 1076|Drosophila melanogaster CG5820-PD,
           isoform D protein.
          Length = 1076

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/77 (49%), Positives = 50/77 (64%)
 Frame = +1

Query: 382 LRGYRQAKCSFLEIGTQKFGDDILDLVVENADPRYPINLXDFMFXKLGLHXVATVKIVNS 561
           +  Y  A CS L++G QKFG DI DLVV N  P+YPI +    F  LGL  VA++KI N 
Sbjct: 268 VNSYLVATCSRLDMGIQKFGSDITDLVVTNVGPKYPILMGPNFFQNLGLKNVASIKIANC 327

Query: 562 TIGYIAPNAFHGVHDLY 612
           T+ Y+   AFHG+++LY
Sbjct: 328 TLEYLHAEAFHGLNELY 344



 Score = 30.3 bits (65), Expect = 2.2
 Identities = 13/35 (37%), Positives = 21/35 (60%)
 Frame = +3

Query: 273 DADNLLDQYEDYEPAEYQEVLYNEDRPCPRDCICS 377
           D D+  D   D    + ++V+++ED PCPR C C+
Sbjct: 231 DDDDDEDDAADDLLTDDEQVVFSEDVPCPRFCQCA 265


>AF247768-1|AAF86228.1|  809|Drosophila melanogaster Toll-4 protein.
          Length = 809

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 3/28 (10%)
 Frame = +3

Query: 306 YEPAEYQEVLYN---EDRPCPRDCICSV 380
           +EP EY+ VL      D  CP DCIC V
Sbjct: 417 HEPMEYETVLRRVEITDDKCPEDCICCV 444


>AE014134-1604|AAF52747.3| 1125|Drosophila melanogaster CG18241-PA
           protein.
          Length = 1125

 Score = 30.7 bits (66), Expect = 1.6
 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 3/28 (10%)
 Frame = +3

Query: 306 YEPAEYQEVLYN---EDRPCPRDCICSV 380
           +EP EY+ VL      D  CP DCIC V
Sbjct: 733 HEPMEYETVLRRVEITDDKCPEDCICCV 760


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 26,043,183
Number of Sequences: 53049
Number of extensions: 529418
Number of successful extensions: 1683
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 1595
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1683
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2517878700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -