SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A06
         (414 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT015189-1|AAT94418.1|   83|Drosophila melanogaster RH57501p pro...    84   8e-17
AJ009557-1|CAA08751.1|   83|Drosophila melanogaster ribosomal pr...    84   8e-17
AE014134-497|AAN10394.1|   83|Drosophila melanogaster CG2986-PD,...    84   8e-17
AE014134-496|AAN10393.1|   83|Drosophila melanogaster CG2986-PC,...    84   8e-17
AE014134-495|AAN10392.1|   83|Drosophila melanogaster CG2986-PB,...    84   8e-17
AE014134-494|AAF51191.1|   83|Drosophila melanogaster CG2986-PA,...    84   8e-17
BT030210-1|ABN49349.1|  158|Drosophila melanogaster IP18075p pro...    65   4e-11
AJ271740-1|CAB93524.1| 16215|Drosophila melanogaster D-Titin pro...    31   0.60 
AJ245406-1|CAB76253.1| 4001|Drosophila melanogaster kettin protein.    31   0.60 
AE014296-406|AAF47604.1| 4796|Drosophila melanogaster CG1915-PA,...    31   0.60 
AE014296-405|AAG22226.2| 18074|Drosophila melanogaster CG1915-PC...    31   0.60 
AB026845-1|BAA90301.2| 4796|Drosophila melanogaster kettin protein.    31   0.60 
X03431-2|CAB57796.1| 1059|Drosophila melanogaster protein ( Dros...    28   4.3  
AF005630-1|AAB70469.1| 1708|Drosophila melanogaster adenylyl cyc...    27   7.4  
AE014298-2169|AAX52499.1| 1690|Drosophila melanogaster CG9210-PB...    27   7.4  
AE014298-2168|AAF48468.1| 1690|Drosophila melanogaster CG9210-PA...    27   7.4  
AY122183-1|AAM52695.1| 1380|Drosophila melanogaster LD40412p pro...    27   9.8  
AE014297-4410|AAF56915.1| 1380|Drosophila melanogaster CG1911-PA...    27   9.8  

>BT015189-1|AAT94418.1|   83|Drosophila melanogaster RH57501p
           protein.
          Length = 83

 Score = 83.8 bits (198), Expect = 8e-17
 Identities = 37/51 (72%), Positives = 40/51 (78%)
 Frame = +2

Query: 146 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 298
           QL I DVDP TGR  D SK Y +CG IRRMGESDDCIVRL KKDGI+ KN+
Sbjct: 33  QLSIVDVDPETGRQTDGSKTYAICGEIRRMGESDDCIVRLAKKDGIITKNF 83



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 28/35 (80%), Positives = 30/35 (85%)
 Frame = +1

Query: 49  MQNDAGEFVDLYCPRKCSASNRLIHAKDHASXTAS 153
           M+NDAGE VDLY PRKCSASNR+IHAKDHAS   S
Sbjct: 1   MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLS 35


>AJ009557-1|CAA08751.1|   83|Drosophila melanogaster ribosomal
           protein S21 protein.
          Length = 83

 Score = 83.8 bits (198), Expect = 8e-17
 Identities = 37/51 (72%), Positives = 40/51 (78%)
 Frame = +2

Query: 146 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 298
           QL I DVDP TGR  D SK Y +CG IRRMGESDDCIVRL KKDGI+ KN+
Sbjct: 33  QLSIVDVDPETGRQTDGSKTYAICGEIRRMGESDDCIVRLAKKDGIITKNF 83



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 28/35 (80%), Positives = 30/35 (85%)
 Frame = +1

Query: 49  MQNDAGEFVDLYCPRKCSASNRLIHAKDHASXTAS 153
           M+NDAGE VDLY PRKCSASNR+IHAKDHAS   S
Sbjct: 1   MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLS 35


>AE014134-497|AAN10394.1|   83|Drosophila melanogaster CG2986-PD,
           isoform D protein.
          Length = 83

 Score = 83.8 bits (198), Expect = 8e-17
 Identities = 37/51 (72%), Positives = 40/51 (78%)
 Frame = +2

Query: 146 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 298
           QL I DVDP TGR  D SK Y +CG IRRMGESDDCIVRL KKDGI+ KN+
Sbjct: 33  QLSIVDVDPETGRQTDGSKTYAICGEIRRMGESDDCIVRLAKKDGIITKNF 83



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 28/35 (80%), Positives = 30/35 (85%)
 Frame = +1

Query: 49  MQNDAGEFVDLYCPRKCSASNRLIHAKDHASXTAS 153
           M+NDAGE VDLY PRKCSASNR+IHAKDHAS   S
Sbjct: 1   MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLS 35


>AE014134-496|AAN10393.1|   83|Drosophila melanogaster CG2986-PC,
           isoform C protein.
          Length = 83

 Score = 83.8 bits (198), Expect = 8e-17
 Identities = 37/51 (72%), Positives = 40/51 (78%)
 Frame = +2

Query: 146 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 298
           QL I DVDP TGR  D SK Y +CG IRRMGESDDCIVRL KKDGI+ KN+
Sbjct: 33  QLSIVDVDPETGRQTDGSKTYAICGEIRRMGESDDCIVRLAKKDGIITKNF 83



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 28/35 (80%), Positives = 30/35 (85%)
 Frame = +1

Query: 49  MQNDAGEFVDLYCPRKCSASNRLIHAKDHASXTAS 153
           M+NDAGE VDLY PRKCSASNR+IHAKDHAS   S
Sbjct: 1   MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLS 35


>AE014134-495|AAN10392.1|   83|Drosophila melanogaster CG2986-PB,
           isoform B protein.
          Length = 83

 Score = 83.8 bits (198), Expect = 8e-17
 Identities = 37/51 (72%), Positives = 40/51 (78%)
 Frame = +2

Query: 146 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 298
           QL I DVDP TGR  D SK Y +CG IRRMGESDDCIVRL KKDGI+ KN+
Sbjct: 33  QLSIVDVDPETGRQTDGSKTYAICGEIRRMGESDDCIVRLAKKDGIITKNF 83



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 28/35 (80%), Positives = 30/35 (85%)
 Frame = +1

Query: 49  MQNDAGEFVDLYCPRKCSASNRLIHAKDHASXTAS 153
           M+NDAGE VDLY PRKCSASNR+IHAKDHAS   S
Sbjct: 1   MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLS 35


>AE014134-494|AAF51191.1|   83|Drosophila melanogaster CG2986-PA,
           isoform A protein.
          Length = 83

 Score = 83.8 bits (198), Expect = 8e-17
 Identities = 37/51 (72%), Positives = 40/51 (78%)
 Frame = +2

Query: 146 QLVIADVDPATGRAADTSKMYVVCGAIRRMGESDDCIVRLTKKDGILAKNY 298
           QL I DVDP TGR  D SK Y +CG IRRMGESDDCIVRL KKDGI+ KN+
Sbjct: 33  QLSIVDVDPETGRQTDGSKTYAICGEIRRMGESDDCIVRLAKKDGIITKNF 83



 Score = 62.9 bits (146), Expect = 2e-10
 Identities = 28/35 (80%), Positives = 30/35 (85%)
 Frame = +1

Query: 49  MQNDAGEFVDLYCPRKCSASNRLIHAKDHASXTAS 153
           M+NDAGE VDLY PRKCSASNR+IHAKDHAS   S
Sbjct: 1   MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLS 35


>BT030210-1|ABN49349.1|  158|Drosophila melanogaster IP18075p
           protein.
          Length = 158

 Score = 64.9 bits (151), Expect = 4e-11
 Identities = 29/36 (80%), Positives = 31/36 (86%)
 Frame = +1

Query: 46  KMQNDAGEFVDLYCPRKCSASNRLIHAKDHASXTAS 153
           KM+NDAGE VDLY PRKCSASNR+IHAKDHAS   S
Sbjct: 16  KMENDAGENVDLYVPRKCSASNRIIHAKDHASVQLS 51



 Score = 32.3 bits (70), Expect = 0.26
 Identities = 14/23 (60%), Positives = 15/23 (65%)
 Frame = +2

Query: 146 QLVIADVDPATGRAADTSKMYVV 214
           QL I DVDP TGR  D SK Y +
Sbjct: 49  QLSIVDVDPETGRQTDGSKTYAI 71


>AJ271740-1|CAB93524.1| 16215|Drosophila melanogaster D-Titin protein.
          Length = 16215

 Score = 31.1 bits (67), Expect = 0.60
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +2

Query: 11   SVNSVYRVDVHIKCRTTPVN--SLTCTARGNARPATASSTLRTMLQXQLVIADVDPATGR 184
            ++ ++   +VH++CR  PV   S+      N +P       R   +   V  D+    G 
Sbjct: 1299 NIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDL---LGC 1355

Query: 185  AADTSKMYVVCGAIRRMGES-DDCIVRLTKKDGIL 286
             A  S +Y  C A  ++GE+   C VR+  K+ ++
Sbjct: 1356 YAIDSGVY-TCQARNQLGEAVTSCSVRIIAKNDLI 1389


>AJ245406-1|CAB76253.1| 4001|Drosophila melanogaster kettin protein.
          Length = 4001

 Score = 31.1 bits (67), Expect = 0.60
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +2

Query: 11   SVNSVYRVDVHIKCRTTPVN--SLTCTARGNARPATASSTLRTMLQXQLVIADVDPATGR 184
            ++ ++   +VH++CR  PV   S+      N +P       R   +   V  D+    G 
Sbjct: 1299 NIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYELDYVALDL---LGC 1355

Query: 185  AADTSKMYVVCGAIRRMGES-DDCIVRLTKKDGIL 286
             A  S +Y  C A  ++GE+   C VR+  K+ ++
Sbjct: 1356 YAIDSGVY-TCQARNQLGEAVTSCSVRIIAKNDLI 1389


>AE014296-406|AAF47604.1| 4796|Drosophila melanogaster CG1915-PA,
            isoform A protein.
          Length = 4796

 Score = 31.1 bits (67), Expect = 0.60
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +2

Query: 11   SVNSVYRVDVHIKCRTTPVN--SLTCTARGNARPATASSTLRTMLQXQLVIADVDPATGR 184
            ++ ++   +VH++CR  PV   S+      N +P       R   +   V  D+    G 
Sbjct: 1299 NIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDL---LGC 1355

Query: 185  AADTSKMYVVCGAIRRMGES-DDCIVRLTKKDGIL 286
             A  S +Y  C A  ++GE+   C VR+  K+ ++
Sbjct: 1356 YAIDSGVY-TCQARNQLGEAVTSCSVRIIAKNDLI 1389


>AE014296-405|AAG22226.2| 18074|Drosophila melanogaster CG1915-PC,
            isoform C protein.
          Length = 18074

 Score = 31.1 bits (67), Expect = 0.60
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +2

Query: 11   SVNSVYRVDVHIKCRTTPVN--SLTCTARGNARPATASSTLRTMLQXQLVIADVDPATGR 184
            ++ ++   +VH++CR  PV   S+      N +P       R   +   V  D+    G 
Sbjct: 1299 NIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDL---LGC 1355

Query: 185  AADTSKMYVVCGAIRRMGES-DDCIVRLTKKDGIL 286
             A  S +Y  C A  ++GE+   C VR+  K+ ++
Sbjct: 1356 YAIDSGVY-TCQARNQLGEAVTSCSVRIIAKNDLI 1389


>AB026845-1|BAA90301.2| 4796|Drosophila melanogaster kettin protein.
          Length = 4796

 Score = 31.1 bits (67), Expect = 0.60
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 3/95 (3%)
 Frame = +2

Query: 11   SVNSVYRVDVHIKCRTTPVN--SLTCTARGNARPATASSTLRTMLQXQLVIADVDPATGR 184
            ++ ++   +VH++CR  PV   S+      N +P       R   +   V  D+    G 
Sbjct: 1299 NIETIEGTNVHLECRLQPVGDPSMRIEWFVNGKPVKTGHRFRPAYEFDYVALDL---LGC 1355

Query: 185  AADTSKMYVVCGAIRRMGES-DDCIVRLTKKDGIL 286
             A  S +Y  C A  ++GE+   C VR+  K+ ++
Sbjct: 1356 YAIDSGVY-TCQARNQLGEAVTSCSVRIIAKNDLI 1389


>X03431-2|CAB57796.1| 1059|Drosophila melanogaster protein (
            Drosophila melanogastertransposable element 297. ).
          Length = 1059

 Score = 28.3 bits (60), Expect = 4.3
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 1/73 (1%)
 Frame = +2

Query: 107  ATASSTLRTMLQXQLVIADVDPATGRAADTSKMY-VVCGAIRRMGESDDCIVRLTKKDGI 283
            A +S  L+  L+ + V   ++ A    AD  +++  +   IR +  SDD  V+L+K + I
Sbjct: 883  AFSSLALKRWLEEEEVELQLNTAKNGVADVERLHKTINEKIRIINSSDDEEVKLSKIETI 942

Query: 284  LAKNY*HLVHQTT 322
            L      + H TT
Sbjct: 943  LYTYNQKIKHDTT 955


>AF005630-1|AAB70469.1| 1708|Drosophila melanogaster adenylyl
           cyclase isoform DAC9 protein.
          Length = 1708

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = -1

Query: 237 PILRIAPQTTYILDVSAARPVAGSTSAITSCX*SMVLSVDEAVAG 103
           P+L  +   T  LD+ AARPV    +  T+   S++ S +  V+G
Sbjct: 753 PVLVESNHRTQTLDIPAARPVLHHAATSTALASSVLRSPEAGVSG 797


>AE014298-2169|AAX52499.1| 1690|Drosophila melanogaster CG9210-PB,
           isoform B protein.
          Length = 1690

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = -1

Query: 237 PILRIAPQTTYILDVSAARPVAGSTSAITSCX*SMVLSVDEAVAG 103
           P+L  +   T  LD+ AARPV    +  T+   S++ S +  V+G
Sbjct: 753 PVLVESNHRTQTLDIPAARPVLHHAATSTALASSVLRSPEAGVSG 797


>AE014298-2168|AAF48468.1| 1690|Drosophila melanogaster CG9210-PA,
           isoform A protein.
          Length = 1690

 Score = 27.5 bits (58), Expect = 7.4
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = -1

Query: 237 PILRIAPQTTYILDVSAARPVAGSTSAITSCX*SMVLSVDEAVAG 103
           P+L  +   T  LD+ AARPV    +  T+   S++ S +  V+G
Sbjct: 753 PVLVESNHRTQTLDIPAARPVLHHAATSTALASSVLRSPEAGVSG 797


>AY122183-1|AAM52695.1| 1380|Drosophila melanogaster LD40412p
           protein.
          Length = 1380

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 17/71 (23%), Positives = 29/71 (40%)
 Frame = -1

Query: 267 VNLTMQSSDSPILRIAPQTTYILDVSAARPVAGSTSAITSCX*SMVLSVDEAVAGRAFPR 88
           + L + +S S    ++  T  I D++    V       TSC   +V S+D     + + R
Sbjct: 740 LQLLIMASQSKSSIVSANTAIIEDIAVGERVRRDPRIFTSCLQLLVNSIDANNTAKYYKR 799

Query: 87  AVQVNEFTGVV 55
                EF G +
Sbjct: 800 QNSDAEFVGKI 810


>AE014297-4410|AAF56915.1| 1380|Drosophila melanogaster CG1911-PA
           protein.
          Length = 1380

 Score = 27.1 bits (57), Expect = 9.8
 Identities = 17/71 (23%), Positives = 29/71 (40%)
 Frame = -1

Query: 267 VNLTMQSSDSPILRIAPQTTYILDVSAARPVAGSTSAITSCX*SMVLSVDEAVAGRAFPR 88
           + L + +S S    ++  T  I D++    V       TSC   +V S+D     + + R
Sbjct: 740 LQLLIMASQSKSSIVSANTAIIEDIAVGERVRRDPRIFTSCLQLLVNSIDANNTAKYYKR 799

Query: 87  AVQVNEFTGVV 55
                EF G +
Sbjct: 800 QNSDAEFVGKI 810


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,340,767
Number of Sequences: 53049
Number of extensions: 283004
Number of successful extensions: 713
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 700
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 713
length of database: 24,988,368
effective HSP length: 78
effective length of database: 20,850,546
effective search space used: 1230182214
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -