SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_A04
         (587 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X62639-1|CAA44505.1|  385|Drosophila melanogaster hrp48.1 protein.    220   1e-57
DQ062784-1|AAY56657.1|  421|Drosophila melanogaster heterogeneou...   220   1e-57
AY128430-1|AAM75023.1|  421|Drosophila melanogaster GH26816p pro...   220   1e-57
AY069699-1|AAL39844.1|  421|Drosophila melanogaster LD46853p pro...   220   1e-57
AE014134-1193|AAN10605.1|  421|Drosophila melanogaster CG10377-P...   220   1e-57
AE014134-1192|AAF52457.1|  421|Drosophila melanogaster CG10377-P...   220   1e-57
AE014134-1191|AAF52456.1|  421|Drosophila melanogaster CG10377-P...   220   1e-57
AY122226-1|AAM52738.1|  369|Drosophila melanogaster RE25373p pro...   121   6e-28
AE014296-2876|AAF49366.3|  369|Drosophila melanogaster CG32169-P...   121   6e-28
X79339-1|CAA55897.1|  606|Drosophila melanogaster musashi protein.    109   4e-24
AY119171-1|AAM51031.1|  634|Drosophila melanogaster RH49436p pro...   109   4e-24
AY051802-1|AAK93226.1|  606|Drosophila melanogaster LD31631p pro...   109   4e-24
AE014297-3816|AAF56478.2|  606|Drosophila melanogaster CG5099-PA...   109   4e-24
AE014297-3812|AAN14056.2|  634|Drosophila melanogaster CG5099-PB...   109   4e-24
M25545-4|AAA28621.1|  361|Drosophila melanogaster protein ( D.me...   103   1e-22
M25545-3|AAA28624.1|  365|Drosophila melanogaster protein ( D.me...   103   1e-22
M25545-2|AAA28623.1|  360|Drosophila melanogaster protein ( D.me...   103   1e-22
M25545-1|AAA28622.1|  364|Drosophila melanogaster protein ( D.me...   103   1e-22
M15766-1|AAA70426.1|  365|Drosophila melanogaster unknown protei...   103   1e-22
AY061448-1|AAL28996.1|  361|Drosophila melanogaster LD38464p pro...   103   1e-22
AE014297-4248|AAN14144.1|  361|Drosophila melanogaster CG9983-PF...   103   1e-22
AE014297-4247|AAN14143.1|  361|Drosophila melanogaster CG9983-PD...   103   1e-22
AE014297-4246|AAN14142.1|  365|Drosophila melanogaster CG9983-PC...   103   1e-22
AE014297-4245|AAF56801.1|  365|Drosophila melanogaster CG9983-PB...   103   1e-22
AE014297-4244|AAN14141.1|  360|Drosophila melanogaster CG9983-PE...   103   1e-22
AE014297-4243|AAF56800.2|  364|Drosophila melanogaster CG9983-PA...   103   1e-22
X62636-1|CAA44502.1|  326|Drosophila melanogaster hrp36.1 protein.    101   7e-22
X59691-1|CAA42212.1|  386|Drosophila melanogaster P11 (hnRNP pro...   101   7e-22
X58183-1|CAA41170.1|  386|Drosophila melanogaster heterogeneous ...   101   7e-22
X54803-1|CAA38574.1|  386|Drosophila melanogaster Hrb87F protein.     101   7e-22
BT012315-1|AAS77440.1|  385|Drosophila melanogaster LD32727p pro...   101   7e-22
AE014297-1716|AAF54967.1|  385|Drosophila melanogaster CG12749-P...   101   7e-22
AE014297-1715|AAN13574.1|  325|Drosophila melanogaster CG12749-P...   101   7e-22
L02106-2|AAA99872.1|  465|Drosophila melanogaster ribonucleoprot...    95   8e-20
L02106-1|AAA99873.1|  471|Drosophila melanogaster ribonucleoprot...    95   8e-20
BT001320-1|AAN71075.1|  434|Drosophila melanogaster AT15526p pro...    95   8e-20
AE014297-4014|AAX53003.1|  434|Drosophila melanogaster CG6354-PE...    95   8e-20
AE014297-4013|AAX53002.1|  434|Drosophila melanogaster CG6354-PD...    95   8e-20
AE014297-4012|AAX53001.1|  471|Drosophila melanogaster CG6354-PI...    95   8e-20
AE014297-4011|AAX53000.1|  471|Drosophila melanogaster CG6354-PH...    95   8e-20
AE014297-4010|AAX52999.1|  471|Drosophila melanogaster CG6354-PF...    95   8e-20
AE014297-4009|AAF56633.1|  471|Drosophila melanogaster CG6354-PB...    95   8e-20
AE014297-4008|AAX52998.1|  465|Drosophila melanogaster CG6354-PG...    95   8e-20
AE014297-4007|AAX52997.1|  465|Drosophila melanogaster CG6354-PC...    95   8e-20
AE014297-4006|AAN14092.1|  465|Drosophila melanogaster CG6354-PA...    95   8e-20
S51720-1|AAB24628.1|   44|Drosophila melanogaster RNA recognitio...    88   7e-18
U18401-1|AAC47508.1|  428|Drosophila melanogaster testis-specifi...    87   1e-17
AY089457-1|AAL90195.1|  428|Drosophila melanogaster AT27014p pro...    87   1e-17
AE014297-1714|AAF54966.1|  428|Drosophila melanogaster CG9654-PA...    87   1e-17
X62638-1|CAA44504.1|  345|Drosophila melanogaster hrp40.2 protein.     83   3e-16
X62637-1|CAA44503.1|  321|Drosophila melanogaster hrp40.1 protein.     83   3e-16
S62100-1|AAB26989.1|  308|Drosophila melanogaster SqdB protein.        83   3e-16
S61875-1|AAB26988.1|  321|Drosophila melanogaster SqdA protein.        83   3e-16
BT023832-1|AAZ86753.1|  308|Drosophila melanogaster LD29474p pro...    83   3e-16
AY118501-1|AAM49870.1|  321|Drosophila melanogaster LD09691p pro...    83   3e-16
AE014297-1708|AAF54964.2|  321|Drosophila melanogaster CG16901-P...    83   3e-16
AE014297-1706|AAF54963.2|  344|Drosophila melanogaster CG16901-P...    83   3e-16
AE014297-1705|AAN13570.1|  308|Drosophila melanogaster CG16901-P...    83   3e-16
BT022083-1|AAY33499.1|  531|Drosophila melanogaster RH39704p pro...    74   2e-13
AY089497-1|AAL90235.1|  531|Drosophila melanogaster GH09868p pro...    74   2e-13
AE013599-3707|AAF47080.2|  332|Drosophila melanogaster CG10327-P...    74   2e-13
AE013599-3706|AAM68274.1|  531|Drosophila melanogaster CG10327-P...    74   2e-13
AE013599-3705|AAF47078.2|  531|Drosophila melanogaster CG10327-P...    74   2e-13
AE013599-3704|AAF47079.2|  531|Drosophila melanogaster CG10327-P...    74   2e-13
AB019707-1|BAA34430.1|  332|Drosophila melanogaster TAR-binding ...    74   2e-13
AB019706-1|BAA34429.1|  531|Drosophila melanogaster TAR-binding ...    74   2e-13
AB019705-1|BAA34428.1|  531|Drosophila melanogaster TAR-binding ...    74   2e-13
AB010261-8|BAA34422.1|  332|Drosophila melanogaster TAR-binding ...    74   2e-13
AB010261-7|BAA34421.1|  531|Drosophila melanogaster TAR-binding ...    74   2e-13
AY118452-1|AAM49821.1|  318|Drosophila melanogaster AT09813p pro...    69   5e-12
AE014296-2502|AAF49643.2|  318|Drosophila melanogaster CG7804-PA...    69   5e-12
S51715-1|AAB24627.1|   44|Drosophila melanogaster RNA recognitio...    62   4e-10
AE014297-773|AAF54259.1|   91|Drosophila melanogaster CG8021-PA ...    60   2e-09
S51693-1|AAB24624.1|   44|Drosophila melanogaster RNA recognitio...    56   4e-08
X79340-1|CAA55898.2|  213|Drosophila melanogaster musashi protein.     53   3e-07
S55886-1|AAB25519.2|  444|Drosophila melanogaster RRM9 protein.        53   3e-07
L04930-2|AAC13646.1|  439|Drosophila melanogaster RNA-binding pr...    53   3e-07
L04930-1|AAC13645.1|  444|Drosophila melanogaster RNA-binding pr...    53   3e-07
BT029936-1|ABM92810.1|  647|Drosophila melanogaster IP15810p pro...    53   3e-07
BT011197-1|AAR88559.1|  439|Drosophila melanogaster GH26440p pro...    53   3e-07
AE014134-520|AAX52651.1|  439|Drosophila melanogaster CG3151-PG,...    53   3e-07
AE014134-519|AAN10403.1|  439|Drosophila melanogaster CG3151-PF,...    53   3e-07
AE014134-518|AAN10402.1|  439|Drosophila melanogaster CG3151-PE,...    53   3e-07
AE014134-517|AAF51178.2|  444|Drosophila melanogaster CG3151-PC,...    53   3e-07
AE014134-516|AAF51177.2|  444|Drosophila melanogaster CG3151-PB,...    53   3e-07
AE014134-515|AAN10401.2|  642|Drosophila melanogaster CG3151-PD,...    53   3e-07
AE014134-514|AAF51179.3|  647|Drosophila melanogaster CG3151-PA,...    53   3e-07
S51695-1|AAB24625.1|   44|Drosophila melanogaster RNA recognitio...    52   6e-07
AE014298-3112|AAN09672.1|   90|Drosophila melanogaster CG33714-P...    51   1e-06
AE014298-3111|AAN09673.1|   90|Drosophila melanogaster CG33714-P...    51   1e-06
BT004860-1|AAO45216.1|  437|Drosophila melanogaster RE27227p pro...    50   2e-06
AF170082-1|AAD47839.1|  419|Drosophila melanogaster cleavage sti...    50   2e-06
AE014297-2555|AAF55577.2|  419|Drosophila melanogaster CG7697-PA...    50   2e-06
AY070612-1|AAL48083.1|  470|Drosophila melanogaster RE71384p pro...    48   3e-06
AE014297-3445|AAN13978.1|  470|Drosophila melanogaster CG5422-PD...    48   3e-06
AE014297-3444|AAN13977.1|  464|Drosophila melanogaster CG5422-PF...    48   3e-06
AE014297-3443|AAF56224.1|  464|Drosophila melanogaster CG5422-PC...    48   3e-06
AE014297-3442|AAF56225.1|  464|Drosophila melanogaster CG5422-PB...    48   3e-06
L13038-1|AAA02941.1|  465|Drosophila melanogaster polyadenylate-...    48   4e-06
L13037-1|AAA28828.1|  465|Drosophila melanogaster polyadenylate-...    48   4e-06
AY121663-1|AAM51990.1|  505|Drosophila melanogaster RE10833p pro...    49   5e-06
AE014297-4216|AAF56774.2|  505|Drosophila melanogaster CG12870-P...    49   5e-06
BT025832-1|ABF85732.1|  791|Drosophila melanogaster IP09238p pro...    48   9e-06
AY069584-1|AAL39729.1|  195|Drosophila melanogaster LD32469p pro...    47   2e-05
AF232775-1|AAF43415.1|  195|Drosophila melanogaster SR family sp...    47   2e-05
AE014134-2203|AAF53192.1|  195|Drosophila melanogaster CG5442-PB...    47   2e-05
AY118842-1|AAM50702.1|  435|Drosophila melanogaster GM13065p pro...    46   3e-05
AE014134-2808|AAF53587.1|  435|Drosophila melanogaster CG12288-P...    46   3e-05
U51858-1|AAC47133.1|  228|Drosophila melanogaster boule protein ...    46   4e-05
BT011495-1|AAR99153.1|   95|Drosophila melanogaster GH12029p pro...    46   4e-05
AY060413-1|AAL25452.1|  307|Drosophila melanogaster LD36772p pro...    46   4e-05
AE014296-1589|AAN11987.1|  189|Drosophila melanogaster CG4760-PC...    46   4e-05
AE014296-1588|AAF50316.3|  189|Drosophila melanogaster CG4760-PA...    46   4e-05
AE014296-1587|AAN11986.1|  228|Drosophila melanogaster CG4760-PD...    46   4e-05
AE014296-1586|AAF50317.3|  228|Drosophila melanogaster CG4760-PB...    46   4e-05
AE013599-3890|AAF47219.1|  307|Drosophila melanogaster CG4612-PA...    46   4e-05
U73846-1|AAB61993.1|  808|Drosophila melanogaster testis-specifi...    46   5e-05
U58976-1|AAB58464.1|  604|Drosophila melanogaster bruno protein.       46   5e-05
AY071420-1|AAL49042.1|  302|Drosophila melanogaster RE50009p pro...    46   5e-05
AY051758-1|AAK93182.1|  604|Drosophila melanogaster LD29068p pro...    46   5e-05
AE014297-279|AAF52006.1|  302|Drosophila melanogaster CG2931-PA ...    46   5e-05
AE014134-2183|AAN10812.1|  604|Drosophila melanogaster CG31762-P...    46   5e-05
AE014134-2182|AAN10811.1|  616|Drosophila melanogaster CG31762-P...    46   5e-05
AE014134-2181|AAN10810.1|  810|Drosophila melanogaster CG31762-P...    46   5e-05
AY069464-1|AAL39609.1|  632|Drosophila melanogaster LD19052p pro...    45   7e-05
AE014134-3163|AAF53845.1|  154|Drosophila melanogaster CG10466-P...    45   7e-05
AE014134-2189|AAF53180.3|  632|Drosophila melanogaster CG31761-P...    45   7e-05
AE014134-2188|AAF53181.2|  632|Drosophila melanogaster CG31761-P...    45   7e-05
AE014134-2187|AAO41184.1|  737|Drosophila melanogaster CG31761-P...    45   7e-05
AE014134-2186|ABI31310.1|  893|Drosophila melanogaster CG31761-P...    45   7e-05
M31162-1|AAA28859.1|  448|Drosophila melanogaster protein ( D.me...    44   2e-04
BT011006-1|AAR27877.1|  690|Drosophila melanogaster AT27578p pro...    44   2e-04
AY089622-1|AAL90360.1|  448|Drosophila melanogaster RE35772p pro...    44   2e-04
AY061501-1|AAL29049.1|  448|Drosophila melanogaster LD46049p pro...    44   2e-04
AY058617-1|AAL13846.1|  690|Drosophila melanogaster LD31194p pro...    44   2e-04
AF231031-1|AAF68949.1|  690|Drosophila melanogaster rasputin pro...    44   2e-04
AE014297-1713|AAN13573.1|  690|Drosophila melanogaster CG9412-PE...    44   2e-04
AE014297-1712|AAN13572.1|  690|Drosophila melanogaster CG9412-PD...    44   2e-04
AE014297-1711|AAN13571.1|  690|Drosophila melanogaster CG9412-PC...    44   2e-04
AE014297-1710|AAG22151.2|  690|Drosophila melanogaster CG9412-PB...    44   2e-04
AE014297-1709|AAF54965.3|  690|Drosophila melanogaster CG9412-PA...    44   2e-04
AE014134-1210|AAF52471.1|  448|Drosophila melanogaster CG8749-PA...    44   2e-04
AY051860-1|AAK93284.1|  594|Drosophila melanogaster LD35730p pro...    44   2e-04
AE014134-1228|AAN10619.1|  287|Drosophila melanogaster CG11266-P...    44   2e-04
AE014134-1227|AAN10618.1|  287|Drosophila melanogaster CG11266-P...    44   2e-04
AE014134-1226|AAN10615.2|  287|Drosophila melanogaster CG11266-P...    44   2e-04
AE014134-1225|AAN10617.1|  287|Drosophila melanogaster CG11266-P...    44   2e-04
AE014134-1224|AAN10616.1|  287|Drosophila melanogaster CG11266-P...    44   2e-04
AE014134-1223|AAN10614.1|  594|Drosophila melanogaster CG11266-P...    44   2e-04
AE014134-1222|AAF52478.1|  594|Drosophila melanogaster CG11266-P...    44   2e-04
AY061421-1|AAL28969.1|  300|Drosophila melanogaster LD35248p pro...    43   3e-04
AF182826-1|AAF01031.1|  300|Drosophila melanogaster cyclophilin-...    43   3e-04
AE013599-2502|AAF57839.1|  300|Drosophila melanogaster CG4886-PA...    43   3e-04
L05109-1|AAA70421.1|  632|Drosophila melanogaster poly(A)-bindin...    43   4e-04
AY118528-1|AAM49897.1|  634|Drosophila melanogaster LD24412p pro...    43   4e-04
AE013599-2628|AAS64811.1|  634|Drosophila melanogaster CG5119-PH...    43   4e-04
AE013599-2627|AAM68178.1|  634|Drosophila melanogaster CG5119-PG...    43   4e-04
AE013599-2626|AAF57747.1|  634|Drosophila melanogaster CG5119-PF...    43   4e-04
AE013599-2625|AAM68177.1|  634|Drosophila melanogaster CG5119-PE...    43   4e-04
AE013599-2624|AAM68176.1|  634|Drosophila melanogaster CG5119-PD...    43   4e-04
AE013599-2623|AAF57746.1|  634|Drosophila melanogaster CG5119-PC...    43   4e-04
AE013599-2622|AAF57745.1|  634|Drosophila melanogaster CG5119-PB...    43   4e-04
AE013599-2621|AAM68175.1|  634|Drosophila melanogaster CG5119-PA...    43   4e-04
AY113652-1|AAM29657.1|  918|Drosophila melanogaster SD14970p pro...    42   5e-04
AE014296-1695|AAF50237.1|  918|Drosophila melanogaster CG3335-PA...    42   5e-04
U59476-1|AAB07067.1|  352|Drosophila melanogaster RNA-binding pr...    42   6e-04
AY061458-1|AAL29006.1|  352|Drosophila melanogaster LD40792p pro...    42   6e-04
AE014296-1235|AAN12056.1|  352|Drosophila melanogaster CG8597-PE...    42   6e-04
AE014296-1234|AAN12055.1|  352|Drosophila melanogaster CG8597-PD...    42   6e-04
AE014296-1233|AAN12054.1|  352|Drosophila melanogaster CG8597-PC...    42   6e-04
AE014296-1232|AAN12053.1|  352|Drosophila melanogaster CG8597-PB...    42   6e-04
AE014296-1231|AAF50578.1|  352|Drosophila melanogaster CG8597-PA...    42   6e-04
AF239667-1|AAF43091.1|  356|Drosophila melanogaster putative RNA...    41   0.001
AE014298-1827|AAF48215.3|  356|Drosophila melanogaster CG4396-PA...    41   0.001
BT001582-1|AAN71337.1|  977|Drosophila melanogaster RE24907p pro...    41   0.001
AY061541-1|AAL29089.1|  392|Drosophila melanogaster LP03039p pro...    41   0.001
AE014297-3637|ABC66187.1|  392|Drosophila melanogaster CG6995-PC...    41   0.001
AE014297-3636|AAF56343.3|  666|Drosophila melanogaster CG6995-PA...    41   0.001
AE014297-3635|AAN14018.2|  928|Drosophila melanogaster CG6995-PB...    41   0.001
AY118564-1|AAM49933.1|  578|Drosophila melanogaster LD40028p pro...    40   0.002
AE014296-940|AAF50792.3|  368|Drosophila melanogaster CG32423-PC...    40   0.002
AE014296-937|AAF50788.5|  578|Drosophila melanogaster CG32423-PA...    40   0.002
AY094948-1|AAM11301.1|  379|Drosophila melanogaster RH63980p pro...    40   0.003
X97197-1|CAA65831.1|  366|Drosophila melanogaster spliceosomal p...    39   0.006
BT023489-1|AAY84889.1|  347|Drosophila melanogaster RE50839p pro...    39   0.006
BT003653-1|AAO39657.1|  626|Drosophila melanogaster AT01548p pro...    39   0.006
AY060398-1|AAL25437.1|  422|Drosophila melanogaster LD31834p pro...    39   0.006
AE014298-857|AAF46136.1|  347|Drosophila melanogaster CG3780-PA ...    39   0.006
AE014297-2864|AAN13834.1|  529|Drosophila melanogaster CG17838-P...    39   0.006
AE014297-2863|AAN13833.1|  529|Drosophila melanogaster CG17838-P...    39   0.006
AE014297-2862|AAF55805.2|  707|Drosophila melanogaster CG17838-P...    39   0.006
AE014297-2861|AAN13831.1|  571|Drosophila melanogaster CG17838-P...    39   0.006
AE014297-2858|AAN13832.2|  563|Drosophila melanogaster CG17838-P...    39   0.006
AE014296-2305|AAF49798.2|  422|Drosophila melanogaster CG12478-P...    39   0.006
AY075220-1|AAL68087.1|  449|Drosophila melanogaster AT16577p pro...    38   0.008
AE013599-3557|AAF46969.1|  449|Drosophila melanogaster CG3162-PA...    38   0.008
AY089405-1|AAL90143.1|  251|Drosophila melanogaster AT22957p pro...    38   0.010
AE014297-2054|AAF55205.1|  251|Drosophila melanogaster CG5213-PA...    38   0.010
BT021281-1|AAX33429.1|  238|Drosophila melanogaster RE36241p pro...    38   0.013
AY061534-1|AAL29082.1|  232|Drosophila melanogaster LP01585p pro...    38   0.013
AE014134-47|AAF51542.1|  238|Drosophila melanogaster CG11454-PA ...    38   0.013
AY071293-1|AAL48915.1|  170|Drosophila melanogaster RE32504p pro...    37   0.018
AE014297-3189|AAF56024.1|  356|Drosophila melanogaster CG6937-PA...    37   0.018
AE014297-952|AAF54387.1|  632|Drosophila melanogaster CG9373-PA ...    37   0.018
S51738-1|AAB24630.1|   44|Drosophila melanogaster RNA recognitio...    37   0.023
BT003317-1|AAO25077.1|  545|Drosophila melanogaster GH01086p pro...    37   0.023
AY061006-1|AAL28554.1|  545|Drosophila melanogaster HL02140p pro...    37   0.023
AF479079-1|AAL86452.1|  637|Drosophila melanogaster half pint pr...    37   0.023
AF190745-1|AAF04132.1|  637|Drosophila melanogaster poly-U bindi...    37   0.023
AE014296-262|AAG22222.2|  545|Drosophila melanogaster CG12085-PD...    37   0.023
AE014296-261|AAF47502.1|  545|Drosophila melanogaster CG12085-PC...    37   0.023
AE014296-260|AAG22221.1|  545|Drosophila melanogaster CG12085-PB...    37   0.023
AE014296-259|AAF47501.1|  637|Drosophila melanogaster CG12085-PA...    37   0.023
L34934-1|AAA73522.1|  224|Drosophila melanogaster RNA binding pr...    36   0.031
BT003274-1|AAO25031.1|  313|Drosophila melanogaster LD15419p pro...    36   0.031
AY075519-1|AAL68327.1|  224|Drosophila melanogaster RE69521p pro...    36   0.031
AY070631-1|AAL48102.1|  224|Drosophila melanogaster RE74211p pro...    36   0.031
AY060253-1|AAL25292.1|  238|Drosophila melanogaster GH07919p pro...    36   0.031
AF116341-1|AAF00976.1|  224|Drosophila melanogaster poly(A)-bind...    36   0.031
AE013599-599|AAM68852.1|  224|Drosophila melanogaster CG2163-PB,...    36   0.031
AE013599-598|AAF59127.1|  224|Drosophila melanogaster CG2163-PA,...    36   0.031
X57484-1|CAA40722.1|  264|Drosophila melanogaster tra-2 protein.       36   0.041
M30939-4|AAA28956.1|  179|Drosophila melanogaster transformer-2 ...    36   0.041
M30939-3|AAA28955.1|  226|Drosophila melanogaster transformer-2 ...    36   0.041
M30939-1|AAA28954.1|  264|Drosophila melanogaster transformer-2 ...    36   0.041
M23633-1|AAA28953.1|  264|Drosophila melanogaster protein ( D.me...    36   0.041
J03155-1|AAA62771.1|  256|Drosophila melanogaster transformer-2 ...    36   0.041
BT010058-1|AAQ22527.1|  865|Drosophila melanogaster LD15974p pro...    36   0.041
BT001315-1|AAN71070.1|  617|Drosophila melanogaster AT14906p pro...    36   0.041
BT001292-1|AAN71048.1|  582|Drosophila melanogaster AT10134p pro...    36   0.041
AY118678-1|AAM50538.1|  582|Drosophila melanogaster AT08247p pro...    36   0.041
AY058768-1|AAL13997.1|  264|Drosophila melanogaster SD04329p pro...    36   0.041
AE014297-3308|AAN13938.2|  559|Drosophila melanogaster CG10868-P...    36   0.041
AE014297-3307|AAN13937.1|  559|Drosophila melanogaster CG10868-P...    36   0.041
AE014297-3306|AAN13936.2|  913|Drosophila melanogaster CG10868-P...    36   0.041
AE014297-3305|AAN13935.1|  913|Drosophila melanogaster CG10868-P...    36   0.041
AE014297-3304|AAF56120.1|  915|Drosophila melanogaster CG10868-P...    36   0.041
AE014296-1825|AAF50154.2|  849|Drosophila melanogaster CG32062-P...    36   0.041
AE014296-1824|AAF50153.2|  881|Drosophila melanogaster CG32062-P...    36   0.041
AE013599-1917|AAM68559.1|  179|Drosophila melanogaster CG10128-P...    36   0.041
AE013599-1916|AAM68558.1|  226|Drosophila melanogaster CG10128-P...    36   0.041
AE013599-1915|AAM68557.1|  226|Drosophila melanogaster CG10128-P...    36   0.041
AE013599-1914|AAS64911.1|  264|Drosophila melanogaster CG10128-P...    36   0.041
AE013599-1913|AAS64910.1|  264|Drosophila melanogaster CG10128-P...    36   0.041
AE013599-1912|AAF58232.2|  264|Drosophila melanogaster CG10128-P...    36   0.041
X62599-1|CAA44483.1|  376|Drosophila melanogaster 52-kD bracketi...    36   0.054
X58720-1|CAA41556.1|  350|Drosophila melanogaster SRp55 protein.       36   0.054
BT003286-1|AAO25044.1|  350|Drosophila melanogaster GM10155p pro...    36   0.054
BT001728-1|AAN71483.1|  470|Drosophila melanogaster RE70333p pro...    36   0.054
BT001495-1|AAN71250.1|  350|Drosophila melanogaster LD30815p pro...    36   0.054
BT001482-1|AAN71237.1|  187|Drosophila melanogaster LD22171p pro...    36   0.054
AY113327-1|AAM29332.1|  350|Drosophila melanogaster AT29232p pro...    36   0.054
AE014297-1722|AAN13578.1|  147|Drosophila melanogaster CG10851-P...    36   0.054
AE014297-1721|AAN13577.1|  135|Drosophila melanogaster CG10851-P...    36   0.054
AE014297-1720|AAF54968.1|  329|Drosophila melanogaster CG10851-P...    36   0.054
AE014297-1719|AAN13576.1|  346|Drosophila melanogaster CG10851-P...    36   0.054
AE014297-1718|AAN13575.1|  350|Drosophila melanogaster CG10851-P...    36   0.054
AE014297-1717|AAF54969.2|  350|Drosophila melanogaster CG10851-P...    36   0.054
AE014296-817|AAF47879.2|  470|Drosophila melanogaster CG1316-PA ...    36   0.054
AY069434-1|AAL39579.1|  589|Drosophila melanogaster LD14125p pro...    35   0.071
AF145664-1|AAD38639.1|  793|Drosophila melanogaster BcDNA.GH1111...    35   0.071
AE013599-555|AAF59160.1|  793|Drosophila melanogaster CG2910-PB,...    35   0.071
AE013599-554|AAM68878.1|  793|Drosophila melanogaster CG2910-PA,...    35   0.071
L23404-1|AAA03548.1|  416|Drosophila melanogaster RNA binding pr...    34   0.16 
AY069320-1|AAL39465.1|  416|Drosophila melanogaster LD03714p pro...    34   0.16 
AE014298-2376|AAF48596.1|  416|Drosophila melanogaster CG9998-PA...    34   0.16 
X64412-1|CAA45757.1|  915|Drosophila melanogaster ovarian protei...    33   0.22 
AY071650-1|AAL49272.1|  361|Drosophila melanogaster RE72594p pro...    33   0.22 
AE014134-2184|AAN10813.1|  361|Drosophila melanogaster CG31762-P...    33   0.22 
BT015266-1|AAT94495.1|  459|Drosophila melanogaster LD33831p pro...    33   0.29 
AY113495-1|AAM29500.1|  330|Drosophila melanogaster RE53017p pro...    33   0.29 
AY071474-1|AAL49096.1|  390|Drosophila melanogaster RE54950p pro...    33   0.29 
AY071251-1|AAL48873.1|  330|Drosophila melanogaster RE29010p pro...    33   0.29 
AY058563-1|AAL13792.1|  652|Drosophila melanogaster LD25239p pro...    33   0.29 
AE014296-2206|AAN11866.1|  430|Drosophila melanogaster CG10948-P...    33   0.29 
AE014296-2205|AAN11865.1|  437|Drosophila melanogaster CG10948-P...    33   0.29 
AE014296-2204|AAF49873.2|  804|Drosophila melanogaster CG10948-P...    33   0.29 
AE014296-1420|AAF50445.2|  652|Drosophila melanogaster CG7185-PA...    33   0.29 
M59448-1|AAA28921.1|  366|Drosophila melanogaster Sxl protein.         33   0.38 
M59447-1|AAA28922.1|  354|Drosophila melanogaster Sx1 protein.         33   0.38 
M23636-1|AAA28884.1|  354|Drosophila melanogaster sex-linked pro...    33   0.38 
BT003583-1|AAO39587.1|  352|Drosophila melanogaster LD15933p pro...    33   0.38 
AY070578-1|AAL48049.1|  154|Drosophila melanogaster RE12122p pro...    33   0.38 
AJ238969-1|CAB53185.1|  154|Drosophila melanogaster cap binding ...    33   0.38 
AE014298-1011|AAZ52512.1|  314|Drosophila melanogaster CG18350-P...    33   0.38 
AE014298-1010|AAO41638.2|  314|Drosophila melanogaster CG18350-P...    33   0.38 
AE014298-1009|AAF46241.3|  339|Drosophila melanogaster CG18350-P...    33   0.38 
AE014298-1008|AAZ52511.1|  354|Drosophila melanogaster CG18350-P...    33   0.38 
AE014298-1007|AAG22410.1|  354|Drosophila melanogaster CG18350-P...    33   0.38 
AE014298-1006|AAN09198.1|  346|Drosophila melanogaster CG18350-P...    33   0.38 
AE014298-1005|AAN09200.2|  346|Drosophila melanogaster CG18350-P...    33   0.38 
AE014298-1004|AAZ52510.1|  344|Drosophila melanogaster CG18350-P...    33   0.38 
AE014298-1003|AAN09197.1|  344|Drosophila melanogaster CG18350-P...    33   0.38 
AE014298-1002|AAF46240.2|  366|Drosophila melanogaster CG18350-P...    33   0.38 
AE014298-1001|AAZ52509.1|  364|Drosophila melanogaster CG18350-P...    33   0.38 
AE014297-2442|AAF55496.1|  154|Drosophila melanogaster CG12357-P...    33   0.38 
L23873-1|AAA28862.1|   48|Drosophila melanogaster Rox2 protein.        32   0.50 
BT003283-1|AAO25040.1|  178|Drosophila melanogaster HL05737p pro...    32   0.50 
BT001384-1|AAN71139.1|  178|Drosophila melanogaster GH03391p pro...    32   0.50 
AY071654-1|AAL49276.1|  384|Drosophila melanogaster RE73487p pro...    32   0.50 
AE014298-2037|AAF48376.4|  205|Drosophila melanogaster CG14414-P...    32   0.50 
AE014297-4497|AAF56982.2|  384|Drosophila melanogaster CG7903-PA...    32   0.50 
AE014297-1707|AAS65146.1|  178|Drosophila melanogaster CG16901-P...    32   0.50 
AY058477-1|AAL13706.1|  529|Drosophila melanogaster GH28335p pro...    32   0.66 
AE014297-2865|AAN13835.1|  529|Drosophila melanogaster CG17838-P...    32   0.66 
BT016009-1|AAV36894.1| 1058|Drosophila melanogaster RE24187p pro...    31   0.88 
BT011019-1|AAR30179.1| 1067|Drosophila melanogaster RE59722p pro...    31   0.88 
BT001380-1|AAN71135.1|  555|Drosophila melanogaster GH02708p pro...    31   0.88 
AY052043-1|AAK93467.1|  704|Drosophila melanogaster LP05645p pro...    31   0.88 
AE014297-89|AAF52127.2| 1088|Drosophila melanogaster CG9809-PA, ...    31   0.88 
AE014297-88|AAN13314.2| 1067|Drosophila melanogaster CG9809-PB, ...    31   0.88 
AE014297-87|AAN13315.2| 1079|Drosophila melanogaster CG9809-PC, ...    31   0.88 
AE014296-1543|AAF50352.1|  551|Drosophila melanogaster CG5735-PA...    31   0.88 
AE014296-1542|AAN11975.1|  704|Drosophila melanogaster CG5735-PD...    31   0.88 
AE014296-1541|AAF50351.1|  704|Drosophila melanogaster CG5735-PC...    31   0.88 
AE014296-1540|AAF50350.1|  704|Drosophila melanogaster CG5735-PB...    31   0.88 
S51727-1|AAB24633.1|   44|Drosophila melanogaster RNA recognitio...    31   1.5  
AY113490-1|AAM29495.1|  158|Drosophila melanogaster RE47308p pro...    31   1.5  
AE014298-1899|AAF48264.2|  158|Drosophila melanogaster CG1987-PA...    31   1.5  
U31961-18|AAA84417.1|  642|Drosophila melanogaster protein ( Dro...    30   2.0  
AY459767-1|AAS15953.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459766-1|AAS15952.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459765-1|AAS15951.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459764-1|AAS15950.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459763-1|AAS15949.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459762-1|AAS15948.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459761-1|AAS15947.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459760-1|AAS15946.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459759-1|AAS15945.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459758-1|AAS15944.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459757-1|AAS15943.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459756-1|AAS15942.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459755-1|AAS15941.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459754-1|AAS15940.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459753-1|AAS15939.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459752-1|AAS15938.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459751-1|AAS15937.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459750-1|AAS15936.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459749-1|AAS15935.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459748-1|AAS15934.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459747-1|AAS15933.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459746-1|AAS15932.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459745-1|AAS15931.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459744-1|AAS15930.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459743-1|AAS15929.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459742-1|AAS15928.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459741-1|AAS15927.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459740-1|AAS15926.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459739-1|AAS15925.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459738-1|AAS15924.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459737-1|AAS15923.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459736-1|AAS15922.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459735-1|AAS15921.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459734-1|AAS15920.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459733-1|AAS15919.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459732-1|AAS15918.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459731-1|AAS15917.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459730-1|AAS15916.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459729-1|AAS15915.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459728-1|AAS15914.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459727-1|AAS15913.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459726-1|AAS15912.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459725-1|AAS15911.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459724-1|AAS15910.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459723-1|AAS15909.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459722-1|AAS15908.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459721-1|AAS15907.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459720-1|AAS15906.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459719-1|AAS15905.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459718-1|AAS15904.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459717-1|AAS15903.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459716-1|AAS15902.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459715-1|AAS15901.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459714-1|AAS15900.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459713-1|AAS15899.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459712-1|AAS15898.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459711-1|AAS15897.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459710-1|AAS15896.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459709-1|AAS15895.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459708-1|AAS15894.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459707-1|AAS15893.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459706-1|AAS15892.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459705-1|AAS15891.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459704-1|AAS15890.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459703-1|AAS15889.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459702-1|AAS15888.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459701-1|AAS15887.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459700-1|AAS15886.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459699-1|AAS15885.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459698-1|AAS15884.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459697-1|AAS15883.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459696-1|AAS15882.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459695-1|AAS15881.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459694-1|AAS15880.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459693-1|AAS15879.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459692-1|AAS15878.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459691-1|AAS15877.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459690-1|AAS15876.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459689-1|AAS15875.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459688-1|AAS15874.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459687-1|AAS15873.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459686-1|AAS15872.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459685-1|AAS15871.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459684-1|AAS15870.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459683-1|AAS15869.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459682-1|AAS15868.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459681-1|AAS15867.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459680-1|AAS15866.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459679-1|AAS15865.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459678-1|AAS15864.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459677-1|AAS15863.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459676-1|AAS15862.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459675-1|AAS15861.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459674-1|AAS15860.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459673-1|AAS15859.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459672-1|AAS15858.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459671-1|AAS15857.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459670-1|AAS15856.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459669-1|AAS15855.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459668-1|AAS15854.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459667-1|AAS15853.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459666-1|AAS15852.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459665-1|AAS15851.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459664-1|AAS15850.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459663-1|AAS15849.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459662-1|AAS15848.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459661-1|AAS15847.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459660-1|AAS15846.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459659-1|AAS15845.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459658-1|AAS15844.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459657-1|AAS15843.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459656-1|AAS15842.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459655-1|AAS15841.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459654-1|AAS15840.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459653-1|AAS15839.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459652-1|AAS15838.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459651-1|AAS15837.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459650-1|AAS15836.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459649-1|AAS15835.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459648-1|AAS15834.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459647-1|AAS15833.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459646-1|AAS15832.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459645-1|AAS15831.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459644-1|AAS15830.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459643-1|AAS15829.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459642-1|AAS15828.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459641-1|AAS15827.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459640-1|AAS15826.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459639-1|AAS15825.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459638-1|AAS15824.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459637-1|AAS15823.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459636-1|AAS15822.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459635-1|AAS15821.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459634-1|AAS15820.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459633-1|AAS15819.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459632-1|AAS15818.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459631-1|AAS15817.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459630-1|AAS15816.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459629-1|AAS15815.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459628-1|AAS15814.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459627-1|AAS15813.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459626-1|AAS15812.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459625-1|AAS15811.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459624-1|AAS15810.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459623-1|AAS15809.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459622-1|AAS15808.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459621-1|AAS15807.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459620-1|AAS15806.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459619-1|AAS15805.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459618-1|AAS15804.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459617-1|AAS15803.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459616-1|AAS15802.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY459615-1|AAS15801.1|   59|Drosophila melanogaster sex lethal p...    30   2.0  
AY119141-1|AAM51001.1|  411|Drosophila melanogaster RE44625p pro...    30   2.0  
AY071005-1|AAL48627.1|  165|Drosophila melanogaster RE09075p pro...    30   2.0  
AE014297-2248|AAF55347.1|  630|Drosophila melanogaster CG10328-P...    30   2.0  
AE013599-786|AAF58987.1|  165|Drosophila melanogaster CG8781-PA ...    30   2.0  
L04929-1|AAA28850.1|  135|Drosophila melanogaster RNA binding pr...    29   3.5  
AY069252-1|AAL39397.1|  144|Drosophila melanogaster GM02602p pro...    29   3.5  
AE014298-2921|AAF49010.2|  580|Drosophila melanogaster CG14230-P...    29   3.5  
AE014297-1200|AAN13488.1|  106|Drosophila melanogaster CG17136-P...    29   3.5  
AE014297-1199|AAN13487.1|  144|Drosophila melanogaster CG17136-P...    29   3.5  
AE014297-1198|AAN13486.1|  135|Drosophila melanogaster CG17136-P...    29   3.5  
AE014297-1197|AAF54555.1|  135|Drosophila melanogaster CG17136-P...    29   3.5  
S51722-1|AAB24629.1|   36|Drosophila melanogaster RNA recognitio...    29   4.7  
AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P...    29   4.7  
AY060995-1|AAL28543.1|  322|Drosophila melanogaster HL01227p pro...    28   8.2  
AF173550-1|AAL29185.1|  165|Drosophila melanogaster Tsunagi prot...    28   8.2  
AE014296-939|AAN12240.1|  499|Drosophila melanogaster CG32423-PD...    28   8.2  
AE014296-938|AAF50790.2|  499|Drosophila melanogaster CG32423-PB...    28   8.2  

>X62639-1|CAA44505.1|  385|Drosophila melanogaster hrp48.1 protein.
          Length = 385

 Score =  220 bits (538), Expect = 1e-57
 Identities = 99/117 (84%), Positives = 109/117 (93%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++DE+GKLFVGGLSWET+QENL RYF R+G++IDCVVMKN+ESGRSRGFGFVTFADP+ 
Sbjct: 1   MEEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTN 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           VN VLQNGPH LDGRTIDPKPCNPRTLQKPK+GGGY KVFLGGLPSNVTETDLR  F
Sbjct: 61  VNHVLQNGPHTLDGRTIDPKPCNPRTLQKPKKGGGY-KVFLGGLPSNVTETDLRTFF 116



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL    ++ +L+ +F+RYG+V + V+M + E  +SRGFGF++F + S V  V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 269 GPHQLDGRTIDPKPCNPR 322
               L+G+ ++ K   PR
Sbjct: 157 RYINLNGKQVEIKKAEPR 174



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/35 (80%), Positives = 29/35 (82%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF RYGKV EVVIMYDQ KKKS G GFLSFE+E S
Sbjct: 115 FFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESS 149



 Score = 33.1 bits (72), Expect = 0.29
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = +1

Query: 520 VDRVTQEHFINLHGKQVXIKRA 585
           V+ VT E +INL+GKQV IK+A
Sbjct: 150 VEHVTNERYINLNGKQVEIKKA 171



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F R+G +++ V+M +    +S G GF++F D
Sbjct: 26  YFCRFGDIIDCVVMKNNESGRSRGFGFVTFAD 57


>DQ062784-1|AAY56657.1|  421|Drosophila melanogaster heterogeneous
           nuclear ribonucleoproteinprotein.
          Length = 421

 Score =  220 bits (538), Expect = 1e-57
 Identities = 99/117 (84%), Positives = 109/117 (93%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++DE+GKLFVGGLSWET+QENL RYF R+G++IDCVVMKN+ESGRSRGFGFVTFADP+ 
Sbjct: 1   MEEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTN 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           VN VLQNGPH LDGRTIDPKPCNPRTLQKPK+GGGY KVFLGGLPSNVTETDLR  F
Sbjct: 61  VNHVLQNGPHTLDGRTIDPKPCNPRTLQKPKKGGGY-KVFLGGLPSNVTETDLRTFF 116



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL    ++ +L+ +F+RYG+V + V+M + E  +SRGFGF++F + S V  V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 269 GPHQLDGRTIDPKPCNPR 322
               L+G+ ++ K   PR
Sbjct: 157 RYINLNGKQVEIKKAEPR 174



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/35 (80%), Positives = 29/35 (82%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF RYGKV EVVIMYDQ KKKS G GFLSFE+E S
Sbjct: 115 FFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESS 149



 Score = 33.1 bits (72), Expect = 0.29
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = +1

Query: 520 VDRVTQEHFINLHGKQVXIKRA 585
           V+ VT E +INL+GKQV IK+A
Sbjct: 150 VEHVTNERYINLNGKQVEIKKA 171



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F R+G +++ V+M +    +S G GF++F D
Sbjct: 26  YFCRFGDIIDCVVMKNNESGRSRGFGFVTFAD 57


>AY128430-1|AAM75023.1|  421|Drosophila melanogaster GH26816p
           protein.
          Length = 421

 Score =  220 bits (538), Expect = 1e-57
 Identities = 99/117 (84%), Positives = 109/117 (93%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++DE+GKLFVGGLSWET+QENL RYF R+G++IDCVVMKN+ESGRSRGFGFVTFADP+ 
Sbjct: 1   MEEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTN 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           VN VLQNGPH LDGRTIDPKPCNPRTLQKPK+GGGY KVFLGGLPSNVTETDLR  F
Sbjct: 61  VNHVLQNGPHTLDGRTIDPKPCNPRTLQKPKKGGGY-KVFLGGLPSNVTETDLRTFF 116



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL    ++ +L+ +F+RYG+V + V+M + E  +SRGFGF++F + S V  V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 269 GPHQLDGRTIDPKPCNPR 322
               L+G+ ++ K   PR
Sbjct: 157 RYINLNGKQVEIKKAEPR 174



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/35 (80%), Positives = 29/35 (82%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF RYGKV EVVIMYDQ KKKS G GFLSFE+E S
Sbjct: 115 FFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESS 149



 Score = 33.1 bits (72), Expect = 0.29
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = +1

Query: 520 VDRVTQEHFINLHGKQVXIKRA 585
           V+ VT E +INL+GKQV IK+A
Sbjct: 150 VEHVTNERYINLNGKQVEIKKA 171



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F R+G +++ V+M +    +S G GF++F D
Sbjct: 26  YFCRFGDIIDCVVMKNNESGRSRGFGFVTFAD 57


>AY069699-1|AAL39844.1|  421|Drosophila melanogaster LD46853p
           protein.
          Length = 421

 Score =  220 bits (538), Expect = 1e-57
 Identities = 99/117 (84%), Positives = 109/117 (93%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++DE+GKLFVGGLSWET+QENL RYF R+G++IDCVVMKN+ESGRSRGFGFVTFADP+ 
Sbjct: 1   MEEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTN 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           VN VLQNGPH LDGRTIDPKPCNPRTLQKPK+GGGY KVFLGGLPSNVTETDLR  F
Sbjct: 61  VNHVLQNGPHTLDGRTIDPKPCNPRTLQKPKKGGGY-KVFLGGLPSNVTETDLRTFF 116



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL    ++ +L+ +F+RYG+V + V+M + E  +SRGFGF++F + S V  V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 269 GPHQLDGRTIDPKPCNPR 322
               L+G+ ++ K   PR
Sbjct: 157 RYINLNGKQVEIKKAEPR 174



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/35 (80%), Positives = 29/35 (82%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF RYGKV EVVIMYDQ KKKS G GFLSFE+E S
Sbjct: 115 FFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESS 149



 Score = 33.1 bits (72), Expect = 0.29
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = +1

Query: 520 VDRVTQEHFINLHGKQVXIKRA 585
           V+ VT E +INL+GKQV IK+A
Sbjct: 150 VEHVTNERYINLNGKQVEIKKA 171



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F R+G +++ V+M +    +S G GF++F D
Sbjct: 26  YFCRFGDIIDCVVMKNNESGRSRGFGFVTFAD 57


>AE014134-1193|AAN10605.1|  421|Drosophila melanogaster CG10377-PC,
           isoform C protein.
          Length = 421

 Score =  220 bits (538), Expect = 1e-57
 Identities = 99/117 (84%), Positives = 109/117 (93%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++DE+GKLFVGGLSWET+QENL RYF R+G++IDCVVMKN+ESGRSRGFGFVTFADP+ 
Sbjct: 1   MEEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTN 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           VN VLQNGPH LDGRTIDPKPCNPRTLQKPK+GGGY KVFLGGLPSNVTETDLR  F
Sbjct: 61  VNHVLQNGPHTLDGRTIDPKPCNPRTLQKPKKGGGY-KVFLGGLPSNVTETDLRTFF 116



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL    ++ +L+ +F+RYG+V + V+M + E  +SRGFGF++F + S V  V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 269 GPHQLDGRTIDPKPCNPR 322
               L+G+ ++ K   PR
Sbjct: 157 RYINLNGKQVEIKKAEPR 174



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/35 (80%), Positives = 29/35 (82%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF RYGKV EVVIMYDQ KKKS G GFLSFE+E S
Sbjct: 115 FFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESS 149



 Score = 33.1 bits (72), Expect = 0.29
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = +1

Query: 520 VDRVTQEHFINLHGKQVXIKRA 585
           V+ VT E +INL+GKQV IK+A
Sbjct: 150 VEHVTNERYINLNGKQVEIKKA 171



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F R+G +++ V+M +    +S G GF++F D
Sbjct: 26  YFCRFGDIIDCVVMKNNESGRSRGFGFVTFAD 57


>AE014134-1192|AAF52457.1|  421|Drosophila melanogaster CG10377-PB,
           isoform B protein.
          Length = 421

 Score =  220 bits (538), Expect = 1e-57
 Identities = 99/117 (84%), Positives = 109/117 (93%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++DE+GKLFVGGLSWET+QENL RYF R+G++IDCVVMKN+ESGRSRGFGFVTFADP+ 
Sbjct: 1   MEEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTN 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           VN VLQNGPH LDGRTIDPKPCNPRTLQKPK+GGGY KVFLGGLPSNVTETDLR  F
Sbjct: 61  VNHVLQNGPHTLDGRTIDPKPCNPRTLQKPKKGGGY-KVFLGGLPSNVTETDLRTFF 116



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL    ++ +L+ +F+RYG+V + V+M + E  +SRGFGF++F + S V  V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 269 GPHQLDGRTIDPKPCNPR 322
               L+G+ ++ K   PR
Sbjct: 157 RYINLNGKQVEIKKAEPR 174



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/35 (80%), Positives = 29/35 (82%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF RYGKV EVVIMYDQ KKKS G GFLSFE+E S
Sbjct: 115 FFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESS 149



 Score = 33.1 bits (72), Expect = 0.29
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = +1

Query: 520 VDRVTQEHFINLHGKQVXIKRA 585
           V+ VT E +INL+GKQV IK+A
Sbjct: 150 VEHVTNERYINLNGKQVEIKKA 171



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F R+G +++ V+M +    +S G GF++F D
Sbjct: 26  YFCRFGDIIDCVVMKNNESGRSRGFGFVTFAD 57


>AE014134-1191|AAF52456.1|  421|Drosophila melanogaster CG10377-PA,
           isoform A protein.
          Length = 421

 Score =  220 bits (538), Expect = 1e-57
 Identities = 99/117 (84%), Positives = 109/117 (93%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M++DE+GKLFVGGLSWET+QENL RYF R+G++IDCVVMKN+ESGRSRGFGFVTFADP+ 
Sbjct: 1   MEEDERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTN 60

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           VN VLQNGPH LDGRTIDPKPCNPRTLQKPK+GGGY KVFLGGLPSNVTETDLR  F
Sbjct: 61  VNHVLQNGPHTLDGRTIDPKPCNPRTLQKPKKGGGY-KVFLGGLPSNVTETDLRTFF 116



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 29/78 (37%), Positives = 49/78 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGL    ++ +L+ +F+RYG+V + V+M + E  +SRGFGF++F + S V  V   
Sbjct: 97  KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNE 156

Query: 269 GPHQLDGRTIDPKPCNPR 322
               L+G+ ++ K   PR
Sbjct: 157 RYINLNGKQVEIKKAEPR 174



 Score = 60.9 bits (141), Expect = 1e-09
 Identities = 28/35 (80%), Positives = 29/35 (82%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF RYGKV EVVIMYDQ KKKS G GFLSFE+E S
Sbjct: 115 FFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESS 149



 Score = 33.1 bits (72), Expect = 0.29
 Identities = 14/22 (63%), Positives = 18/22 (81%)
 Frame = +1

Query: 520 VDRVTQEHFINLHGKQVXIKRA 585
           V+ VT E +INL+GKQV IK+A
Sbjct: 150 VEHVTNERYINLNGKQVEIKKA 171



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 11/32 (34%), Positives = 21/32 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFED 509
           +F R+G +++ V+M +    +S G GF++F D
Sbjct: 26  YFCRFGDIIDCVVMKNNESGRSRGFGFVTFAD 57


>AY122226-1|AAM52738.1|  369|Drosophila melanogaster RE25373p
           protein.
          Length = 369

 Score =  121 bits (292), Expect = 6e-28
 Identities = 56/120 (46%), Positives = 81/120 (67%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P    ++ GK+F+GGLSW+TS E+L+ YF RYG++ + +VMK+  + RSRGFGFVTF+D
Sbjct: 20  SPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSD 79

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           P+ V+ VL  G H+LDG+ +DPK   PR    PK      K+F+GGL +  T  D++  F
Sbjct: 80  PNSVDKVLTQGTHELDGKKVDPKVAFPRRAH-PKMVTRTKKIFVGGLSAPTTLEDVKSYF 138



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 33/95 (34%), Positives = 58/95 (61%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R +P M    K K+FVGGLS  T+ E+++ YF ++G + D ++M + ++ R RGFGFVTF
Sbjct: 108 RAHPKMVTRTK-KIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTF 166

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
               +V+ V +   H+++ + ++ K   P+ +  P
Sbjct: 167 QSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLP 201



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 15/35 (42%), Positives = 23/35 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +FGRYG + E ++M D   ++S G GF++F D  S
Sbjct: 48  YFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNS 82



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 9/33 (27%), Positives = 22/33 (66%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++G + + ++M+D+   +  G GF++F+ E
Sbjct: 137 YFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSE 169


>AE014296-2876|AAF49366.3|  369|Drosophila melanogaster CG32169-PA
           protein.
          Length = 369

 Score =  121 bits (292), Expect = 6e-28
 Identities = 56/120 (46%), Positives = 81/120 (67%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P    ++ GK+F+GGLSW+TS E+L+ YF RYG++ + +VMK+  + RSRGFGFVTF+D
Sbjct: 20  SPSEVPNDPGKMFIGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFGFVTFSD 79

Query: 239 PSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           P+ V+ VL  G H+LDG+ +DPK   PR    PK      K+F+GGL +  T  D++  F
Sbjct: 80  PNSVDKVLTQGTHELDGKKVDPKVAFPRRAH-PKMVTRTKKIFVGGLSAPTTLEDVKSYF 138



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 33/95 (34%), Positives = 58/95 (61%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           R +P M    K K+FVGGLS  T+ E+++ YF ++G + D ++M + ++ R RGFGFVTF
Sbjct: 108 RAHPKMVTRTK-KIFVGGLSAPTTLEDVKSYFEQFGPIEDAMLMFDKQTNRHRGFGFVTF 166

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKP 337
               +V+ V +   H+++ + ++ K   P+ +  P
Sbjct: 167 QSEDVVDKVCEIHFHEINNKMVECKKAQPKEVMLP 201



 Score = 39.9 bits (89), Expect = 0.002
 Identities = 15/35 (42%), Positives = 23/35 (65%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +FGRYG + E ++M D   ++S G GF++F D  S
Sbjct: 48  YFGRYGDISEAMVMKDPTTRRSRGFGFVTFSDPNS 82



 Score = 31.1 bits (67), Expect = 1.2
 Identities = 9/33 (27%), Positives = 22/33 (66%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++G + + ++M+D+   +  G GF++F+ E
Sbjct: 137 YFEQFGPIEDAMLMFDKQTNRHRGFGFVTFQSE 169


>X79339-1|CAA55897.1|  606|Drosophila melanogaster musashi protein.
          Length = 606

 Score =  109 bits (261), Expect = 4e-24
 Identities = 49/115 (42%), Positives = 74/115 (64%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   GKLFVGGLSW+TS + L+ YF+ +G V D ++MK+  + RSRGFGF+TF +P  V 
Sbjct: 171 DPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVE 230

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            VL+   H LDG+ IDPK   P+   +P++     K+F+GG+  + +  +++  F
Sbjct: 231 KVLKVPIHTLDGKKIDPKHATPK--NRPRQANKTKKIFVGGVSQDTSAEEVKAYF 283



 Score = 68.5 bits (160), Expect = 6e-12
 Identities = 33/97 (34%), Positives = 57/97 (58%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+S +TS E ++ YFS++G V + V++ + ++ R RGFGFVTF +  +V+ V + 
Sbjct: 264 KIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEI 323

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGL 379
             H +  + ++ K   P+    P       ++ LG L
Sbjct: 324 HFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTL 360



 Score = 36.7 bits (81), Expect = 0.023
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++G V E V++ DQ  K+  G GF++FE+E
Sbjct: 282 YFSQFGPVEETVMLMDQQTKRHRGFGFVTFENE 314


>AY119171-1|AAM51031.1|  634|Drosophila melanogaster RH49436p
           protein.
          Length = 634

 Score =  109 bits (261), Expect = 4e-24
 Identities = 49/115 (42%), Positives = 74/115 (64%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   GKLFVGGLSW+TS + L+ YF+ +G V D ++MK+  + RSRGFGF+TF +P  V 
Sbjct: 199 DPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVE 258

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            VL+   H LDG+ IDPK   P+   +P++     K+F+GG+  + +  +++  F
Sbjct: 259 KVLKVPIHTLDGKKIDPKHATPK--NRPRQANKTKKIFVGGVSQDTSAEEVKAYF 311



 Score = 68.5 bits (160), Expect = 6e-12
 Identities = 33/97 (34%), Positives = 57/97 (58%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+S +TS E ++ YFS++G V + V++ + ++ R RGFGFVTF +  +V+ V + 
Sbjct: 292 KIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEI 351

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGL 379
             H +  + ++ K   P+    P       ++ LG L
Sbjct: 352 HFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTL 388



 Score = 36.7 bits (81), Expect = 0.023
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++G V E V++ DQ  K+  G GF++FE+E
Sbjct: 310 YFSQFGPVEETVMLMDQQTKRHRGFGFVTFENE 342


>AY051802-1|AAK93226.1|  606|Drosophila melanogaster LD31631p
           protein.
          Length = 606

 Score =  109 bits (261), Expect = 4e-24
 Identities = 49/115 (42%), Positives = 74/115 (64%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   GKLFVGGLSW+TS + L+ YF+ +G V D ++MK+  + RSRGFGF+TF +P  V 
Sbjct: 171 DPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVE 230

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            VL+   H LDG+ IDPK   P+   +P++     K+F+GG+  + +  +++  F
Sbjct: 231 KVLKVPIHTLDGKKIDPKHATPK--NRPRQANKTKKIFVGGVSQDTSAEEVKAYF 283



 Score = 68.5 bits (160), Expect = 6e-12
 Identities = 33/97 (34%), Positives = 57/97 (58%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+S +TS E ++ YFS++G V + V++ + ++ R RGFGFVTF +  +V+ V + 
Sbjct: 264 KIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEI 323

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGL 379
             H +  + ++ K   P+    P       ++ LG L
Sbjct: 324 HFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTL 360



 Score = 36.7 bits (81), Expect = 0.023
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++G V E V++ DQ  K+  G GF++FE+E
Sbjct: 282 YFSQFGPVEETVMLMDQQTKRHRGFGFVTFENE 314


>AE014297-3816|AAF56478.2|  606|Drosophila melanogaster CG5099-PA,
           isoform A protein.
          Length = 606

 Score =  109 bits (261), Expect = 4e-24
 Identities = 49/115 (42%), Positives = 74/115 (64%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   GKLFVGGLSW+TS + L+ YF+ +G V D ++MK+  + RSRGFGF+TF +P  V 
Sbjct: 171 DPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVE 230

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            VL+   H LDG+ IDPK   P+   +P++     K+F+GG+  + +  +++  F
Sbjct: 231 KVLKVPIHTLDGKKIDPKHATPK--NRPRQANKTKKIFVGGVSQDTSAEEVKAYF 283



 Score = 68.5 bits (160), Expect = 6e-12
 Identities = 33/97 (34%), Positives = 57/97 (58%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+S +TS E ++ YFS++G V + V++ + ++ R RGFGFVTF +  +V+ V + 
Sbjct: 264 KIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEI 323

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGL 379
             H +  + ++ K   P+    P       ++ LG L
Sbjct: 324 HFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTL 360



 Score = 36.7 bits (81), Expect = 0.023
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++G V E V++ DQ  K+  G GF++FE+E
Sbjct: 282 YFSQFGPVEETVMLMDQQTKRHRGFGFVTFENE 314


>AE014297-3812|AAN14056.2|  634|Drosophila melanogaster CG5099-PB,
           isoform B protein.
          Length = 634

 Score =  109 bits (261), Expect = 4e-24
 Identities = 49/115 (42%), Positives = 74/115 (64%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   GKLFVGGLSW+TS + L+ YF+ +G V D ++MK+  + RSRGFGF+TF +P  V 
Sbjct: 199 DPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKDPVTQRSRGFGFITFQEPCTVE 258

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            VL+   H LDG+ IDPK   P+   +P++     K+F+GG+  + +  +++  F
Sbjct: 259 KVLKVPIHTLDGKKIDPKHATPK--NRPRQANKTKKIFVGGVSQDTSAEEVKAYF 311



 Score = 68.5 bits (160), Expect = 6e-12
 Identities = 33/97 (34%), Positives = 57/97 (58%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVGG+S +TS E ++ YFS++G V + V++ + ++ R RGFGFVTF +  +V+ V + 
Sbjct: 292 KIFVGGVSQDTSAEEVKAYFSQFGPVEETVMLMDQQTKRHRGFGFVTFENEDVVDRVCEI 351

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGL 379
             H +  + ++ K   P+    P       ++ LG L
Sbjct: 352 HFHTIKNKKVECKKAQPKEAVTPAAQLLQKRIMLGTL 388



 Score = 36.7 bits (81), Expect = 0.023
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           +F ++G V E V++ DQ  K+  G GF++FE+E
Sbjct: 310 YFSQFGPVEETVMLMDQQTKRHRGFGFVTFENE 342


>M25545-4|AAA28621.1|  361|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 361

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 28  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 87

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 88  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 139



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 119 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 178

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 179 KQHQLNGKMVDVKKALPK--QNDQQGGG 204



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 47  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 75


>M25545-3|AAA28624.1|  365|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 365

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 32  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 91

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 92  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 143



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 123 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 182

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 183 KQHQLNGKMVDVKKALPK--QNDQQGGG 208



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 51  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 79


>M25545-2|AAA28623.1|  360|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 360

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 27  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 86

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 87  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 138



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 118 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 177

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 178 KQHQLNGKMVDVKKALPK--QNDQQGGG 203



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 46  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 74


>M25545-1|AAA28622.1|  364|Drosophila melanogaster protein (
           D.melanogaster Hrb98DElocus encoding heterogeneous
           nuclear ribonucleoproteinisoforms, exon 5. ).
          Length = 364

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 31  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 90

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 91  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 142



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 122 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 181

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 182 KQHQLNGKMVDVKKALPK--QNDQQGGG 207



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 50  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 78


>M15766-1|AAA70426.1|  365|Drosophila melanogaster unknown protein
           protein.
          Length = 365

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 32  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 91

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 92  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 143



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 123 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 182

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 183 KQHQLNGKMVDVKKALPK--QNDQQGGG 208



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 51  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 79


>AY061448-1|AAL28996.1|  361|Drosophila melanogaster LD38464p
           protein.
          Length = 361

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 28  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 87

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 88  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 139



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 119 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 178

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 179 KQHQLNGKMVDVKKALPK--QNDQQGGG 204



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 47  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 75


>AE014297-4248|AAN14144.1|  361|Drosophila melanogaster CG9983-PF,
           isoform F protein.
          Length = 361

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 28  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 87

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 88  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 139



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 119 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 178

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 179 KQHQLNGKMVDVKKALPK--QNDQQGGG 204



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 47  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 75


>AE014297-4247|AAN14143.1|  361|Drosophila melanogaster CG9983-PD,
           isoform D protein.
          Length = 361

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 28  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 87

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 88  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 139



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 119 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 178

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 179 KQHQLNGKMVDVKKALPK--QNDQQGGG 204



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 47  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 75


>AE014297-4246|AAN14142.1|  365|Drosophila melanogaster CG9983-PC,
           isoform C protein.
          Length = 365

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 32  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 91

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 92  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 143



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 123 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 182

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 183 KQHQLNGKMVDVKKALPK--QNDQQGGG 208



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 51  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 79


>AE014297-4245|AAF56801.1|  365|Drosophila melanogaster CG9983-PB,
           isoform B protein.
          Length = 365

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 32  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 91

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 92  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 143



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 123 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 182

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 183 KQHQLNGKMVDVKKALPK--QNDQQGGG 208



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 51  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 79


>AE014297-4244|AAN14141.1|  360|Drosophila melanogaster CG9983-PE,
           isoform E protein.
          Length = 360

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 27  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 86

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 87  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 138



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 118 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 177

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 178 KQHQLNGKMVDVKKALPK--QNDQQGGG 203



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 46  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 74


>AE014297-4243|AAF56800.2|  364|Drosophila melanogaster CG9983-PA,
           isoform A protein.
          Length = 364

 Score =  103 bits (248), Expect = 1e-22
 Identities = 44/112 (39%), Positives = 73/112 (65%), Gaps = 1/112 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL + T+ ENL+ +F ++G ++D VVMK+  + RSRGFGF+T++  S+++   ++
Sbjct: 31  KLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRGFGFITYSHSSMIDEAQKS 90

Query: 269 GPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
            PH++DGR ++PK   PR  +  P  G    K+F+G L  +  E  +R  F+
Sbjct: 91  RPHKIDGRVVEPKRAVPRQDIDSPNAGATVKKLFVGALKDDHDEQSIRDYFQ 142



 Score = 69.7 bits (163), Expect = 3e-12
 Identities = 32/88 (36%), Positives = 54/88 (61%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L  +  +++++ YF  +G ++D  ++ + E+G+ RGF FV F D   V+ V+  
Sbjct: 122 KLFVGALKDDHDEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQ 181

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             HQL+G+ +D K   P+  Q  ++GGG
Sbjct: 182 KQHQLNGKMVDVKKALPK--QNDQQGGG 207



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 50  FEKWGNIVDVVVMKDPRTKRSRGFGFITY 78


>X62636-1|CAA44502.1|  326|Drosophila melanogaster hrp36.1 protein.
          Length = 326

 Score =  101 bits (242), Expect = 7e-22
 Identities = 44/118 (37%), Positives = 75/118 (63%), Gaps = 1/118 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGL + T+ + L+ +F ++G ++D VVMK+ ++ RSRGFGF+T++   ++
Sbjct: 19  EPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMI 78

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
           +      PH++DGRT++PK   PR  +  P  G    K+F+GGL  +  E  LR  F+
Sbjct: 79  DNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFK 136



 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 27/88 (30%), Positives = 49/88 (55%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  +  +E L+ YF  +G+++   ++ + ++G+ RGF F+ F D   V+ ++  
Sbjct: 116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ 175

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             H +  +T+D K    +     + GGG
Sbjct: 176 KTHSIKNKTLDVKKAIAKQDMDRQGGGG 203



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 44  FEKWGNIVDVVVMKDPKTKRSRGFGFITY 72


>X59691-1|CAA42212.1|  386|Drosophila melanogaster P11 (hnRNP
           protein) protein.
          Length = 386

 Score =  101 bits (242), Expect = 7e-22
 Identities = 44/118 (37%), Positives = 75/118 (63%), Gaps = 1/118 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGL + T+ + L+ +F ++G ++D VVMK+ ++ RSRGFGF+T++   ++
Sbjct: 19  EPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMI 78

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
           +      PH++DGRT++PK   PR  +  P  G    K+F+GGL  +  E  LR  F+
Sbjct: 79  DNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFK 136



 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 27/88 (30%), Positives = 49/88 (55%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  +  +E L+ YF  +G+++   ++ + ++G+ RGF F+ F D   V+ ++  
Sbjct: 116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ 175

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             H +  +T+D K    +     + GGG
Sbjct: 176 KTHSIKNKTLDVKKAIAKQDMDRQGGGG 203



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 44  FEKWGNIVDVVVMKDPKTKRSRGFGFITY 72


>X58183-1|CAA41170.1|  386|Drosophila melanogaster heterogeneous
           nuclear ribonucleoproteinprotein.
          Length = 386

 Score =  101 bits (242), Expect = 7e-22
 Identities = 44/118 (37%), Positives = 75/118 (63%), Gaps = 1/118 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGL + T+ + L+ +F ++G ++D VVMK+ ++ RSRGFGF+T++   ++
Sbjct: 19  EPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMI 78

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
           +      PH++DGRT++PK   PR  +  P  G    K+F+GGL  +  E  LR  F+
Sbjct: 79  DNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFK 136



 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 27/88 (30%), Positives = 49/88 (55%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  +  +E L+ YF  +G+++   ++ + ++G+ RGF F+ F D   V+ ++  
Sbjct: 116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ 175

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             H +  +T+D K    +     + GGG
Sbjct: 176 KTHSIKNKTLDVKKAIAKQDMDRQGGGG 203



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 44  FEKWGNIVDVVVMKDPKTKRSRGFGFITY 72


>X54803-1|CAA38574.1|  386|Drosophila melanogaster Hrb87F protein.
          Length = 386

 Score =  101 bits (242), Expect = 7e-22
 Identities = 44/118 (37%), Positives = 75/118 (63%), Gaps = 1/118 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGL + T+ + L+ +F ++G ++D VVMK+ ++ RSRGFGF+T++   ++
Sbjct: 19  EPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMI 78

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
           +      PH++DGRT++PK   PR  +  P  G    K+F+GGL  +  E  LR  F+
Sbjct: 79  DNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFK 136



 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 27/88 (30%), Positives = 49/88 (55%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  +  +E L+ YF  +G+++   ++ + ++G+ RGF F+ F D   V+ ++  
Sbjct: 116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ 175

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             H +  +T+D K    +     + GGG
Sbjct: 176 KTHSIKNKTLDVKKAIAKQDMDRQGGGG 203



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 44  FEKWGNIVDVVVMKDPKTKRSRGFGFITY 72


>BT012315-1|AAS77440.1|  385|Drosophila melanogaster LD32727p
           protein.
          Length = 385

 Score =  101 bits (242), Expect = 7e-22
 Identities = 44/118 (37%), Positives = 75/118 (63%), Gaps = 1/118 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGL + T+ + L+ +F ++G ++D VVMK+ ++ RSRGFGF+T++   ++
Sbjct: 19  EPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMI 78

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
           +      PH++DGRT++PK   PR  +  P  G    K+F+GGL  +  E  LR  F+
Sbjct: 79  DNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFK 136



 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 27/88 (30%), Positives = 49/88 (55%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  +  +E L+ YF  +G+++   ++ + ++G+ RGF F+ F D   V+ ++  
Sbjct: 116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ 175

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             H +  +T+D K    +     + GGG
Sbjct: 176 KTHSIKNKTLDVKKAIAKQDMDRQGGGG 203



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 44  FEKWGNIVDVVVMKDPKTKRSRGFGFITY 72


>AE014297-1716|AAF54967.1|  385|Drosophila melanogaster CG12749-PA,
           isoform A protein.
          Length = 385

 Score =  101 bits (242), Expect = 7e-22
 Identities = 44/118 (37%), Positives = 75/118 (63%), Gaps = 1/118 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGL + T+ + L+ +F ++G ++D VVMK+ ++ RSRGFGF+T++   ++
Sbjct: 19  EPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMI 78

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
           +      PH++DGRT++PK   PR  +  P  G    K+F+GGL  +  E  LR  F+
Sbjct: 79  DNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFK 136



 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 27/88 (30%), Positives = 49/88 (55%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  +  +E L+ YF  +G+++   ++ + ++G+ RGF F+ F D   V+ ++  
Sbjct: 116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ 175

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             H +  +T+D K    +     + GGG
Sbjct: 176 KTHSIKNKTLDVKKAIAKQDMDRQGGGG 203



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 44  FEKWGNIVDVVVMKDPKTKRSRGFGFITY 72


>AE014297-1715|AAN13574.1|  325|Drosophila melanogaster CG12749-PB,
           isoform B protein.
          Length = 325

 Score =  101 bits (242), Expect = 7e-22
 Identities = 44/118 (37%), Positives = 75/118 (63%), Gaps = 1/118 (0%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           + ++  KLF+GGL + T+ + L+ +F ++G ++D VVMK+ ++ RSRGFGF+T++   ++
Sbjct: 19  EPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMI 78

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPR-TLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFR 421
           +      PH++DGRT++PK   PR  +  P  G    K+F+GGL  +  E  LR  F+
Sbjct: 79  DNAQNARPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFK 136



 Score = 62.1 bits (144), Expect = 5e-10
 Identities = 27/88 (30%), Positives = 49/88 (55%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL  +  +E L+ YF  +G+++   ++ + ++G+ RGF F+ F D   V+ ++  
Sbjct: 116 KLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDDYDPVDKIILQ 175

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGG 352
             H +  +T+D K    +     + GGG
Sbjct: 176 KTHSIKNKTLDVKKAIAKQDMDRQGGGG 203



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 11/29 (37%), Positives = 21/29 (72%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F ++G +++VV+M D   K+S G GF+++
Sbjct: 44  FEKWGNIVDVVVMKDPKTKRSRGFGFITY 72


>L02106-2|AAA99872.1|  465|Drosophila melanogaster ribonucleoprotein
           protein.
          Length = 465

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>L02106-1|AAA99873.1|  471|Drosophila melanogaster ribonucleoprotein
           protein.
          Length = 471

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>BT001320-1|AAN71075.1|  434|Drosophila melanogaster AT15526p
           protein.
          Length = 434

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>AE014297-4014|AAX53003.1|  434|Drosophila melanogaster CG6354-PE,
           isoform E protein.
          Length = 434

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>AE014297-4013|AAX53002.1|  434|Drosophila melanogaster CG6354-PD,
           isoform D protein.
          Length = 434

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>AE014297-4012|AAX53001.1|  471|Drosophila melanogaster CG6354-PI,
           isoform I protein.
          Length = 471

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>AE014297-4011|AAX53000.1|  471|Drosophila melanogaster CG6354-PH,
           isoform H protein.
          Length = 471

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>AE014297-4010|AAX52999.1|  471|Drosophila melanogaster CG6354-PF,
           isoform F protein.
          Length = 471

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>AE014297-4009|AAF56633.1|  471|Drosophila melanogaster CG6354-PB,
           isoform B protein.
          Length = 471

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>AE014297-4008|AAX52998.1|  465|Drosophila melanogaster CG6354-PG,
           isoform G protein.
          Length = 465

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>AE014297-4007|AAX52997.1|  465|Drosophila melanogaster CG6354-PC,
           isoform C protein.
          Length = 465

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>AE014297-4006|AAN14092.1|  465|Drosophila melanogaster CG6354-PA,
           isoform A protein.
          Length = 465

 Score = 94.7 bits (225), Expect = 8e-20
 Identities = 44/111 (39%), Positives = 73/111 (65%), Gaps = 1/111 (0%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+GGL+  T++ENL+ ++ ++G+V+D VVM+++ + RSRGFGF+T+    +V+   +N
Sbjct: 33  KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQEN 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGG-GYPKVFLGGLPSNVTETDLRXIF 418
            PH +DG+T++ K   PR  ++ +       K+F+GGL  N  E  LR  F
Sbjct: 93  RPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF 143



 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVGGL     +E L+ YF ++G V+   ++ +  +G+ RGF FV F D   V+  +  
Sbjct: 124 KLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILK 183

Query: 269 GPHQLDGRTIDPK 307
             H +    +D K
Sbjct: 184 KQHAIKYVHVDVK 196



 Score = 38.7 bits (86), Expect = 0.006
 Identities = 14/30 (46%), Positives = 24/30 (80%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSF 503
           F+G++GKV++VV+M D   K+S G GF+++
Sbjct: 51  FYGQWGKVVDVVVMRDAATKRSRGFGFITY 80


>S51720-1|AAB24628.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 88.2 bits (209), Expect = 7e-18
 Identities = 37/44 (84%), Positives = 42/44 (95%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           FVGGLSWET+QENL RYF R+G++IDCVVMKN+ESGRSRGFGFV
Sbjct: 1   FVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFV 44


>U18401-1|AAC47508.1|  428|Drosophila melanogaster
           testis-specific-RRM-protein protein.
          Length = 428

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 42/92 (45%), Positives = 60/92 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGLS +T+ E L+ +FS++G V D VV+++  S  SRGFGFVT+ DP  V +V + 
Sbjct: 33  KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRA 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKV 364
            PH +D + ++ K   PR  Q  KRGGG   V
Sbjct: 93  RPHTIDNKIVETKHALPR--QDFKRGGGVGSV 122



 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQR-YFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++F+GGL  E   EN+ R YFS++G V    ++ + E+GR R FGF+ F DPS     L 
Sbjct: 137 RIFLGGLK-EYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
              H +    ++ K    R+ QK  R   +P
Sbjct: 196 PRKHWILQTLVEVK----RSTQKADRRFRFP 222



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF ++G V + V++ D     S G GF+++ D  S
Sbjct: 51  FFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKS 85


>AY089457-1|AAL90195.1|  428|Drosophila melanogaster AT27014p
           protein.
          Length = 428

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 42/92 (45%), Positives = 60/92 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGLS +T+ E L+ +FS++G V D VV+++  S  SRGFGFVT+ DP  V +V + 
Sbjct: 33  KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRA 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKV 364
            PH +D + ++ K   PR  Q  KRGGG   V
Sbjct: 93  RPHTIDNKIVETKHALPR--QDFKRGGGVGSV 122



 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQR-YFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++F+GGL  E   EN+ R YFS++G V    ++ + E+GR R FGF+ F DPS     L 
Sbjct: 137 RIFLGGLK-EYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
              H +    ++ K    R+ QK  R   +P
Sbjct: 196 PRKHWILQTLVEVK----RSTQKADRRFRFP 222



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF ++G V + V++ D     S G GF+++ D  S
Sbjct: 51  FFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKS 85


>AE014297-1714|AAF54966.1|  428|Drosophila melanogaster CG9654-PA
           protein.
          Length = 428

 Score = 87.4 bits (207), Expect = 1e-17
 Identities = 42/92 (45%), Positives = 60/92 (65%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GGLS +T+ E L+ +FS++G V D VV+++  S  SRGFGFVT+ DP  V +V + 
Sbjct: 33  KIFIGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKSVEIVQRA 92

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKV 364
            PH +D + ++ K   PR  Q  KRGGG   V
Sbjct: 93  RPHTIDNKIVETKHALPR--QDFKRGGGVGSV 122



 Score = 52.4 bits (120), Expect = 4e-07
 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 1/91 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQR-YFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ 265
           ++F+GGL  E   EN+ R YFS++G V    ++ + E+GR R FGF+ F DPS     L 
Sbjct: 137 RIFLGGLK-EYHDENIVREYFSQFGPVASVKLLMDRETGRQRAFGFLEFVDPSSAEKALA 195

Query: 266 NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
              H +    ++ K    R+ QK  R   +P
Sbjct: 196 PRKHWILQTLVEVK----RSTQKADRRFRFP 222



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/35 (34%), Positives = 20/35 (57%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           FF ++G V + V++ D     S G GF+++ D  S
Sbjct: 51  FFSQFGIVADAVVLRDPVSNHSRGFGFVTYVDPKS 85


>X62638-1|CAA44504.1|  345|Drosophila melanogaster hrp40.2 protein.
          Length = 345

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/114 (33%), Positives = 67/114 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  KLFVGGLSWET+++ L+ +F +YGE+    V  + ++GRSRGF F+ F +   ++ 
Sbjct: 53  DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V     H ++ + +DPK    R          + K+F+GGL + +++ +++  F
Sbjct: 113 VSAADEHIINSKKVDPKKAKAR----------HGKIFVGGLTTEISDEEIKTYF 156



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++P       GK+FVGGL+ E S E ++ YF ++G +++  +  + +  + +GF F+TF
Sbjct: 125 KVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITF 184

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDL 406
               +V  +L+    ++ G+ +D K   P+  +    GG  G P+   GG+         
Sbjct: 185 DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP-ENQMMGGMRGGPR---GGMRGGRGGYGG 240

Query: 407 RXIFRTLWEGHG--GGH 451
           R  +   W+G G  GG+
Sbjct: 241 RGGYNNQWDGQGSYGGY 257


>X62637-1|CAA44503.1|  321|Drosophila melanogaster hrp40.1 protein.
          Length = 321

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/114 (33%), Positives = 67/114 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  KLFVGGLSWET+++ L+ +F +YGE+    V  + ++GRSRGF F+ F +   ++ 
Sbjct: 53  DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V     H ++ + +DPK    R          + K+F+GGL + +++ +++  F
Sbjct: 113 VSAADEHIINSKKVDPKKAKAR----------HGKIFVGGLTTEISDEEIKTYF 156



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++P       GK+FVGGL+ E S E ++ YF ++G +++  +  + +  + +GF F+TF
Sbjct: 125 KVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITF 184

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDL 406
               +V  +L+    ++ G+ +D K   P+  +    GG  G P+   GG+         
Sbjct: 185 DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP-ENQMMGGMRGGPR---GGMRGGRGGYGG 240

Query: 407 RXIFRTLWEGHG--GGH 451
           R  +   W+G G  GG+
Sbjct: 241 RGGYNNQWDGQGSYGGY 257


>S62100-1|AAB26989.1|  308|Drosophila melanogaster SqdB protein.
          Length = 308

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/114 (33%), Positives = 67/114 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  KLFVGGLSWET+++ L+ +F +YGE+    V  + ++GRSRGF F+ F +   ++ 
Sbjct: 53  DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V     H ++ + +DPK    R          + K+F+GGL + +++ +++  F
Sbjct: 113 VSAADEHIINSKKVDPKKAKAR----------HGKIFVGGLTTEISDEEIKTYF 156



 Score = 64.9 bits (151), Expect = 8e-11
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++P       GK+FVGGL+ E S E ++ YF ++G +++  +  + +  + +GF F+TF
Sbjct: 125 KVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPLDKQKSQRKGFCFITF 184

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDL 406
               +V  +L+    ++ G+ +D K   P+  +    GG  G P+   GG+         
Sbjct: 185 DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP-ENQMMGGMRGGPR---GGMRGGRGGYGG 240

Query: 407 RXIFRTLWEGHG--GGH 451
           R  +   W+G G  GG+
Sbjct: 241 RGGYNNQWDGQGSYGGY 257


>S61875-1|AAB26988.1|  321|Drosophila melanogaster SqdA protein.
          Length = 321

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/114 (33%), Positives = 67/114 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  KLFVGGLSWET+++ L+ +F +YGE+    V  + ++GRSRGF F+ F +   ++ 
Sbjct: 53  DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V     H ++ + +DPK    R          + K+F+GGL + +++ +++  F
Sbjct: 113 VSAADEHIINSKKVDPKKAKAR----------HGKIFVGGLTTEISDEEIKTYF 156



 Score = 64.9 bits (151), Expect = 8e-11
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++P       GK+FVGGL+ E S E ++ YF ++G +++  +  + +  + +GF F+TF
Sbjct: 125 KVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPLDKQKSQRKGFCFITF 184

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDL 406
               +V  +L+    ++ G+ +D K   P+  +    GG  G P+   GG+         
Sbjct: 185 DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP-ENQMMGGMRGGPR---GGMRGGRGGYGG 240

Query: 407 RXIFRTLWEGHG--GGH 451
           R  +   W+G G  GG+
Sbjct: 241 RGGYNNQWDGQGSYGGY 257


>BT023832-1|AAZ86753.1|  308|Drosophila melanogaster LD29474p
           protein.
          Length = 308

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/114 (33%), Positives = 67/114 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  KLFVGGLSWET+++ L+ +F +YGE+    V  + ++GRSRGF F+ F +   ++ 
Sbjct: 53  DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V     H ++ + +DPK    R          + K+F+GGL + +++ +++  F
Sbjct: 113 VSAADEHIINSKKVDPKKAKAR----------HGKIFVGGLTTEISDEEIKTYF 156



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++P       GK+FVGGL+ E S E ++ YF ++G +++  +  + +  + +GF F+TF
Sbjct: 125 KVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITF 184

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDL 406
               +V  +L+    ++ G+ +D K   P+  +    GG  G P+   GG+         
Sbjct: 185 DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP-ENQMMGGMRGGPR---GGMRGGRGGYGG 240

Query: 407 RXIFRTLWEGHG--GGH 451
           R  +   W+G G  GG+
Sbjct: 241 RGGYNNQWDGQGSYGGY 257


>AY118501-1|AAM49870.1|  321|Drosophila melanogaster LD09691p
           protein.
          Length = 321

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/114 (33%), Positives = 67/114 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  KLFVGGLSWET+++ L+ +F +YGE+    V  + ++GRSRGF F+ F +   ++ 
Sbjct: 53  DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V     H ++ + +DPK    R          + K+F+GGL + +++ +++  F
Sbjct: 113 VSAADEHIINSKKVDPKKAKAR----------HGKIFVGGLTTEISDEEIKTYF 156



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++P       GK+FVGGL+ E S E ++ YF ++G +++  +  + +  + +GF F+TF
Sbjct: 125 KVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITF 184

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDL 406
               +V  +L+    ++ G+ +D K   P+  +    GG  G P+   GG+         
Sbjct: 185 DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP-ENQMMGGMRGGPR---GGMRGGRGGYGG 240

Query: 407 RXIFRTLWEGHG--GGH 451
           R  +   W+G G  GG+
Sbjct: 241 RGGYNNQWDGQGSYGGY 257


>AE014297-1708|AAF54964.2|  321|Drosophila melanogaster CG16901-PA,
           isoform A protein.
          Length = 321

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/114 (33%), Positives = 67/114 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  KLFVGGLSWET+++ L+ +F +YGE+    V  + ++GRSRGF F+ F +   ++ 
Sbjct: 53  DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V     H ++ + +DPK    R          + K+F+GGL + +++ +++  F
Sbjct: 113 VSAADEHIINSKKVDPKKAKAR----------HGKIFVGGLTTEISDEEIKTYF 156



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++P       GK+FVGGL+ E S E ++ YF ++G +++  +  + +  + +GF F+TF
Sbjct: 125 KVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITF 184

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDL 406
               +V  +L+    ++ G+ +D K   P+  +    GG  G P+   GG+         
Sbjct: 185 DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP-ENQMMGGMRGGPR---GGMRGGRGGYGG 240

Query: 407 RXIFRTLWEGHG--GGH 451
           R  +   W+G G  GG+
Sbjct: 241 RGGYNNQWDGQGSYGGY 257


>AE014297-1706|AAF54963.2|  344|Drosophila melanogaster CG16901-PB,
           isoform B protein.
          Length = 344

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/114 (33%), Positives = 67/114 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  KLFVGGLSWET+++ L+ +F +YGE+    V  + ++GRSRGF F+ F +   ++ 
Sbjct: 53  DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V     H ++ + +DPK    R          + K+F+GGL + +++ +++  F
Sbjct: 113 VSAADEHIINSKKVDPKKAKAR----------HGKIFVGGLTTEISDEEIKTYF 156



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++P       GK+FVGGL+ E S E ++ YF ++G +++  +  + +  + +GF F+TF
Sbjct: 125 KVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITF 184

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDL 406
               +V  +L+    ++ G+ +D K   P+  +    GG  G P+   GG+         
Sbjct: 185 DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP-ENQMMGGMRGGPR---GGMRGGRGGYGG 240

Query: 407 RXIFRTLWEGHG--GGH 451
           R  +   W+G G  GG+
Sbjct: 241 RGGYNNQWDGQGSYGGY 257


>AE014297-1705|AAN13570.1|  308|Drosophila melanogaster CG16901-PC,
           isoform C protein.
          Length = 308

 Score = 83.0 bits (196), Expect = 3e-16
 Identities = 38/114 (33%), Positives = 67/114 (58%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  KLFVGGLSWET+++ L+ +F +YGE+    V  + ++GRSRGF F+ F +   ++ 
Sbjct: 53  DDDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDK 112

Query: 257 VLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           V     H ++ + +DPK    R          + K+F+GGL + +++ +++  F
Sbjct: 113 VSAADEHIINSKKVDPKKAKAR----------HGKIFVGGLTTEISDEEIKTYF 156



 Score = 64.5 bits (150), Expect = 1e-10
 Identities = 37/137 (27%), Positives = 69/137 (50%), Gaps = 4/137 (2%)
 Frame = +2

Query: 53  RMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +++P       GK+FVGGL+ E S E ++ YF ++G +++  +  + +  + +GF F+TF
Sbjct: 125 KVDPKKAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITF 184

Query: 233 ADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGG--GYPKVFLGGLPSNVTETDL 406
               +V  +L+    ++ G+ +D K   P+  +    GG  G P+   GG+         
Sbjct: 185 DSEQVVTDLLKTPKQKIAGKEVDVKRATPKP-ENQMMGGMRGGPR---GGMRGGRGGYGG 240

Query: 407 RXIFRTLWEGHG--GGH 451
           R  +   W+G G  GG+
Sbjct: 241 RGGYNNQWDGQGSYGGY 257


>BT022083-1|AAY33499.1|  531|Drosophila melanogaster RH39704p
           protein.
          Length = 531

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++E+L+ YF  YGEV+   + K+++SG+S+GFGFV F        VL N 
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K  N + +     G   P KVF+G    ++   DLR  F    E
Sbjct: 168 RHLIDGRWCEVKVPNSKGM-----GHQVPCKVFVGRCTEDINSDDLREYFSKFGE 217



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG  + + + ++L+ YFS++GEV D  + +       R F FVTF DP +    L  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQ-SLCG 246

Query: 269 GPHQLDGRTIDPKPCNPRTLQ 331
             H + G ++      P+  Q
Sbjct: 247 EDHIIKGVSVHVSNAAPKAEQ 267


>AY089497-1|AAL90235.1|  531|Drosophila melanogaster GH09868p
           protein.
          Length = 531

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++E+L+ YF  YGEV+   + K+++SG+S+GFGFV F        VL N 
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K  N + +     G   P KVF+G    ++   DLR  F    E
Sbjct: 168 RHLIDGRWCEVKVPNSKGM-----GHQVPCKVFVGRCTEDINSDDLREYFSKFGE 217



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG  + + + ++L+ YFS++GEV D  + +       R F FVTF DP +    L  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQ-SLCG 246

Query: 269 GPHQLDGRTIDPKPCNPRTLQ 331
             H + G ++      P+  Q
Sbjct: 247 EDHIIKGVSVHVSNAAPKAEQ 267


>AE013599-3707|AAF47080.2|  332|Drosophila melanogaster CG10327-PA,
           isoform A protein.
          Length = 332

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++E+L+ YF  YGEV+   + K+++SG+S+GFGFV F        VL N 
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K  N + +     G   P KVF+G    ++   DLR  F    E
Sbjct: 168 RHLIDGRWCEVKVPNSKGM-----GHQVPCKVFVGRCTEDINSDDLREYFSKFGE 217



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG  + + + ++L+ YFS++GEV D  + +       R F FVTF DP +    L  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQ-SLCG 246

Query: 269 GPHQLDGRTIDPKPCNPRTLQ 331
             H + G ++      P+  Q
Sbjct: 247 EDHIIKGVSVHVSNAAPKAEQ 267


>AE013599-3706|AAM68274.1|  531|Drosophila melanogaster CG10327-PD,
           isoform D protein.
          Length = 531

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++E+L+ YF  YGEV+   + K+++SG+S+GFGFV F        VL N 
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K  N + +     G   P KVF+G    ++   DLR  F    E
Sbjct: 168 RHLIDGRWCEVKVPNSKGM-----GHQVPCKVFVGRCTEDINSDDLREYFSKFGE 217



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG  + + + ++L+ YFS++GEV D  + +       R F FVTF DP +    L  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQ-SLCG 246

Query: 269 GPHQLDGRTIDPKPCNPRTLQ 331
             H + G ++      P+  Q
Sbjct: 247 EDHIIKGVSVHVSNAAPKAEQ 267


>AE013599-3705|AAF47078.2|  531|Drosophila melanogaster CG10327-PC,
           isoform C protein.
          Length = 531

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++E+L+ YF  YGEV+   + K+++SG+S+GFGFV F        VL N 
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K  N + +     G   P KVF+G    ++   DLR  F    E
Sbjct: 168 RHLIDGRWCEVKVPNSKGM-----GHQVPCKVFVGRCTEDINSDDLREYFSKFGE 217



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG  + + + ++L+ YFS++GEV D  + +       R F FVTF DP +    L  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQ-SLCG 246

Query: 269 GPHQLDGRTIDPKPCNPRTLQ 331
             H + G ++      P+  Q
Sbjct: 247 EDHIIKGVSVHVSNAAPKAEQ 267


>AE013599-3704|AAF47079.2|  531|Drosophila melanogaster CG10327-PB,
           isoform B protein.
          Length = 531

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++E+L+ YF  YGEV+   + K+++SG+S+GFGFV F        VL N 
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K  N + +     G   P KVF+G    ++   DLR  F    E
Sbjct: 168 RHLIDGRWCEVKVPNSKGM-----GHQVPCKVFVGRCTEDINSDDLREYFSKFGE 217



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG  + + + ++L+ YFS++GEV D  + +       R F FVTF DP +    L  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQ-SLCG 246

Query: 269 GPHQLDGRTIDPKPCNPRTLQ 331
             H + G ++      P+  Q
Sbjct: 247 EDHIIKGVSVHVSNAAPKAEQ 267


>AB019707-1|BAA34430.1|  332|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 332

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++E+L+ YF  YGEV+   + K+++SG+S+GFGFV F        VL N 
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K  N + +     G   P KVF+G    ++   DLR  F    E
Sbjct: 168 RHLIDGRWCEVKVPNSKGM-----GHQVPCKVFVGRCTEDINSDDLREYFSKFGE 217



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG  + + + ++L+ YFS++GEV D  + +       R F FVTF DP +    L  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQ-SLCG 246

Query: 269 GPHQLDGRTIDPKPCNPRTLQ 331
             H + G ++      P+  Q
Sbjct: 247 EDHIIKGVSVHVSNAAPKAEQ 267


>AB019706-1|BAA34429.1|  531|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 531

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++E+L+ YF  YGEV+   + K+++SG+S+GFGFV F        VL N 
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K  N + +     G   P KVF+G    ++   DLR  F    E
Sbjct: 168 RHLIDGRWCEVKVPNSKGM-----GHQVPCKVFVGRCTEDINSDDLREYFSKFGE 217



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG  + + + ++L+ YFS++GEV D  + +       R F FVTF DP +    L  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQ-SLCG 246

Query: 269 GPHQLDGRTIDPKPCNPRTLQ 331
             H + G ++      P+  Q
Sbjct: 247 EDHIIKGVSVHVSNAAPKAEQ 267


>AB019705-1|BAA34428.1|  531|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 531

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++E+L+ YF  YGEV+   + K+++SG+S+GFGFV F        VL N 
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K  N + +     G   P KVF+G    ++   DLR  F    E
Sbjct: 168 RHLIDGRWCEVKVPNSKGM-----GHQVPCKVFVGRCTEDINSDDLREYFSKFGE 217



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG  + + + ++L+ YFS++GEV D  + +       R F FVTF DP +    L  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQ-SLCG 246

Query: 269 GPHQLDGRTIDPKPCNPRTLQ 331
             H + G ++      P+  Q
Sbjct: 247 EDHIIKGVSVHVSNAAPKAEQ 267


>AB010261-8|BAA34422.1|  332|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 332

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++E+L+ YF  YGEV+   + K+++SG+S+GFGFV F        VL N 
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K  N + +     G   P KVF+G    ++   DLR  F    E
Sbjct: 168 RHLIDGRWCEVKVPNSKGM-----GHQVPCKVFVGRCTEDINSDDLREYFSKFGE 217



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG  + + + ++L+ YFS++GEV D  + +       R F FVTF DP +    L  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQ-SLCG 246

Query: 269 GPHQLDGRTIDPKPCNPRTLQ 331
             H + G ++      P+  Q
Sbjct: 247 EDHIIKGVSVHVSNAAPKAEQ 267


>AB010261-7|BAA34421.1|  531|Drosophila melanogaster TAR-binding
           protein protein.
          Length = 531

 Score = 73.7 bits (173), Expect = 2e-13
 Identities = 44/115 (38%), Positives = 63/115 (54%), Gaps = 1/115 (0%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GL W+T++E+L+ YF  YGEV+   + K+++SG+S+GFGFV F        VL N 
Sbjct: 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYP-KVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K  N + +     G   P KVF+G    ++   DLR  F    E
Sbjct: 168 RHLIDGRWCEVKVPNSKGM-----GHQVPCKVFVGRCTEDINSDDLREYFSKFGE 217



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 25/81 (30%), Positives = 41/81 (50%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG  + + + ++L+ YFS++GEV D  + +       R F FVTF DP +    L  
Sbjct: 193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQ-SLCG 246

Query: 269 GPHQLDGRTIDPKPCNPRTLQ 331
             H + G ++      P+  Q
Sbjct: 247 EDHIIKGVSVHVSNAAPKAEQ 267


>AY118452-1|AAM49821.1|  318|Drosophila melanogaster AT09813p
           protein.
          Length = 318

 Score = 68.9 bits (161), Expect = 5e-12
 Identities = 40/114 (35%), Positives = 60/114 (52%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GLS+ T++++L+ YF  YG+V+   + K++ SG S+GFGFV F    +   VL   
Sbjct: 109 LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSK- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K    R +   + G    KVF+G    ++   DLR  F    E
Sbjct: 168 RHSIDGRWCEVKVPASRGMGNQEPG----KVFVGRCTEDIEADDLREYFSKFGE 217



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 30/88 (34%), Positives = 47/88 (53%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M + E GK+FVG  + +   ++L+ YFS++GEVID  + K       R F FVTF DP  
Sbjct: 186 MGNQEPGKVFVGRCTEDIEADDLREYFSKFGEVIDVFIPK-----PFRAFSFVTFLDP-Y 239

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQ 331
           V  V+    H + G ++     + + +Q
Sbjct: 240 VPRVVCGEKHIIKGVSVHVSTADKKNVQ 267


>AE014296-2502|AAF49643.2|  318|Drosophila melanogaster CG7804-PA
           protein.
          Length = 318

 Score = 68.9 bits (161), Expect = 5e-12
 Identities = 40/114 (35%), Positives = 60/114 (52%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L V GLS+ T++++L+ YF  YG+V+   + K++ SG S+GFGFV F    +   VL   
Sbjct: 109 LIVLGLSYNTTEQDLREYFETYGDVVKAEIKKDTRSGHSKGFGFVRFGSYDVQMHVLSK- 167

Query: 272 PHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWE 433
            H +DGR  + K    R +   + G    KVF+G    ++   DLR  F    E
Sbjct: 168 RHSIDGRWCEVKVPASRGMGNQEPG----KVFVGRCTEDIEADDLREYFSKFGE 217



 Score = 50.8 bits (116), Expect = 1e-06
 Identities = 30/88 (34%), Positives = 47/88 (53%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           M + E GK+FVG  + +   ++L+ YFS++GEVID  + K       R F FVTF DP  
Sbjct: 186 MGNQEPGKVFVGRCTEDIEADDLREYFSKFGEVIDVFIPK-----PFRAFSFVTFLDP-Y 239

Query: 248 VNLVLQNGPHQLDGRTIDPKPCNPRTLQ 331
           V  V+    H + G ++     + + +Q
Sbjct: 240 VPRVVCGEKHIIKGVSVHVSTADKKNVQ 267


>S51715-1|AAB24627.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 62.5 bits (145), Expect = 4e-10
 Identities = 26/44 (59%), Positives = 35/44 (79%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           FVGGLSW+TS E+L+ YF RYG++ + +VMK+  + RSRGF FV
Sbjct: 1   FVGGLSWQTSPESLRDYFGRYGDISEAMVMKDPTTRRSRGFAFV 44



 Score = 31.5 bits (68), Expect = 0.88
 Identities = 11/28 (39%), Positives = 18/28 (64%)
 Frame = +3

Query: 414 FFGRYGKVMEVVIMYDQXKKKSXGXGFL 497
           +FGRYG + E ++M D   ++S G  F+
Sbjct: 17  YFGRYGDISEAMVMKDPTTRRSRGFAFV 44


>AE014297-773|AAF54259.1|   91|Drosophila melanogaster CG8021-PA
           protein.
          Length = 91

 Score = 60.1 bits (139), Expect = 2e-09
 Identities = 28/76 (36%), Positives = 40/76 (52%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG L W    + L+ YFS+YG V +  V+ + + G S+ +GFV F+     N     
Sbjct: 11  KLFVGNLPWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQ 70

Query: 269 GPHQLDGRTIDPKPCN 316
             H LDGR +  +  N
Sbjct: 71  NTHFLDGRVLTVQRAN 86


>S51693-1|AAB24624.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 56.0 bits (129), Expect = 4e-08
 Identities = 22/44 (50%), Positives = 34/44 (77%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           FVGGLSWET+++ L+ +F +YGE+ +  V  + ++GRSRGF F+
Sbjct: 1   FVGGLSWETTEKELRDHFGKYGEIENINVKTDPQTGRSRGFAFI 44


>X79340-1|CAA55898.2|  213|Drosophila melanogaster musashi protein.
          Length = 213

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 21/39 (53%), Positives = 29/39 (74%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKN 190
           D   GKLFVGGLSW+TS + L+ YF+ +G V D ++MK+
Sbjct: 171 DPAPGKLFVGGLSWQTSSDKLKEYFNMFGTVTDVLIMKD 209


>S55886-1|AAB25519.2|  444|Drosophila melanogaster RRM9 protein.
          Length = 444

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 101 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 160

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 161 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 214

Query: 413 IF 418
           +F
Sbjct: 215 LF 216



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 363 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 421


>L04930-2|AAC13646.1|  439|Drosophila melanogaster RNA-binding
           protein protein.
          Length = 439

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 101 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 160

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 161 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 214

Query: 413 IF 418
           +F
Sbjct: 215 LF 216



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P  +  +   L+V GL    +Q +L+  FS YG++I   ++ ++ +G S+G GF+ F
Sbjct: 188 PSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRF 244



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 358 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 416


>L04930-1|AAC13645.1|  444|Drosophila melanogaster RNA-binding
           protein protein.
          Length = 444

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 101 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 160

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 161 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 214

Query: 413 IF 418
           +F
Sbjct: 215 LF 216



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 363 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 421


>BT029936-1|ABM92810.1|  647|Drosophila melanogaster IP15810p
           protein.
          Length = 647

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 304 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 363

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 364 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 417

Query: 413 IF 418
           +F
Sbjct: 418 LF 419



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 566 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 624


>BT011197-1|AAR88559.1|  439|Drosophila melanogaster GH26440p
           protein.
          Length = 439

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 101 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 160

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 161 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 214

Query: 413 IF 418
           +F
Sbjct: 215 LF 216



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P  +  +   L+V GL    +Q +L+  FS YG++I   ++ ++ +G S+G GF+ F
Sbjct: 188 PSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRF 244



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 358 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 416


>AE014134-520|AAX52651.1|  439|Drosophila melanogaster CG3151-PG,
           isoform G protein.
          Length = 439

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 101 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 160

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 161 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 214

Query: 413 IF 418
           +F
Sbjct: 215 LF 216



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P  +  +   L+V GL    +Q +L+  FS YG++I   ++ ++ +G S+G GF+ F
Sbjct: 188 PSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRF 244



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 358 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 416


>AE014134-519|AAN10403.1|  439|Drosophila melanogaster CG3151-PF,
           isoform F protein.
          Length = 439

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 101 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 160

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 161 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 214

Query: 413 IF 418
           +F
Sbjct: 215 LF 216



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P  +  +   L+V GL    +Q +L+  FS YG++I   ++ ++ +G S+G GF+ F
Sbjct: 188 PSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRF 244



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 358 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 416


>AE014134-518|AAN10402.1|  439|Drosophila melanogaster CG3151-PE,
           isoform E protein.
          Length = 439

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 101 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 160

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 161 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 214

Query: 413 IF 418
           +F
Sbjct: 215 LF 216



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P  +  +   L+V GL    +Q +L+  FS YG++I   ++ ++ +G S+G GF+ F
Sbjct: 188 PSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRF 244



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 358 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 416


>AE014134-517|AAF51178.2|  444|Drosophila melanogaster CG3151-PC,
           isoform C protein.
          Length = 444

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 101 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 160

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 161 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 214

Query: 413 IF 418
           +F
Sbjct: 215 LF 216



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 363 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 421


>AE014134-516|AAF51177.2|  444|Drosophila melanogaster CG3151-PB,
           isoform B protein.
          Length = 444

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 101 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 160

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 161 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 214

Query: 413 IF 418
           +F
Sbjct: 215 LF 216



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 363 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 421


>AE014134-515|AAN10401.2|  642|Drosophila melanogaster CG3151-PD,
           isoform D protein.
          Length = 642

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 304 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 363

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 364 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 417

Query: 413 IF 418
           +F
Sbjct: 418 LF 419



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 18/57 (31%), Positives = 33/57 (57%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P  +  +   L+V GL    +Q +L+  FS YG++I   ++ ++ +G S+G GF+ F
Sbjct: 391 PSSESIKGANLYVSGLPKNMTQSDLESLFSPYGKIITSRILCDNITGLSKGVGFIRF 447



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 561 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 619


>AE014134-514|AAF51179.3|  647|Drosophila melanogaster CG3151-PA,
           isoform A protein.
          Length = 647

 Score = 52.8 bits (121), Expect = 3e-07
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 2/122 (1%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           N + + D K  L V  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV +  
Sbjct: 304 NNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFVNYVK 363

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
                  +   NG  +L  +TI      P +  +  +G     +++ GLP N+T++DL  
Sbjct: 364 QEDAEKAINALNG-LRLQNKTIKVSIARPSS--ESIKGA---NLYVSGLPKNMTQSDLES 417

Query: 413 IF 418
           +F
Sbjct: 418 LF 419



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 566 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 624


>S51695-1|AAB24625.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 52.0 bits (119), Expect = 6e-07
 Identities = 23/44 (52%), Positives = 33/44 (75%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           FVGGLS +T+ E L+ +FS++G V D VV+++  S  SRGFGF+
Sbjct: 1   FVGGLSTQTTVETLRGFFSQFGIVADAVVLRDPVSNHSRGFGFM 44


>AE014298-3112|AAN09672.1|   90|Drosophila melanogaster CG33714-PB,
           isoform B protein.
          Length = 90

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++FVG L W    + L+ YF  +G V+   V+ +  +G S+G+GFV+F   + +  +   
Sbjct: 16  RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENE 75

Query: 269 GPHQLDGRTID 301
             H L+G  ++
Sbjct: 76  QKHILEGNYLN 86


>AE014298-3111|AAN09673.1|   90|Drosophila melanogaster CG33714-PA,
           isoform A protein.
          Length = 90

 Score = 51.2 bits (117), Expect = 1e-06
 Identities = 21/71 (29%), Positives = 39/71 (54%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++FVG L W    + L+ YF  +G V+   V+ +  +G S+G+GFV+F   + +  +   
Sbjct: 16  RIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALEKIENE 75

Query: 269 GPHQLDGRTID 301
             H L+G  ++
Sbjct: 76  QKHILEGNYLN 86


>BT004860-1|AAO45216.1|  437|Drosophila melanogaster RE27227p
           protein.
          Length = 437

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D     +FVG + +E ++E L+  FS  G V+   ++ + ESG+ +GFGF  + D     
Sbjct: 12  DKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETAL 71

Query: 254 LVLQN-GPHQLDGRTI 298
             ++N   +++ GRT+
Sbjct: 72  SAMRNLNGYEIGGRTL 87


>AF170082-1|AAD47839.1|  419|Drosophila melanogaster cleavage
           stimulation factor 64kilodalton subunit protein.
          Length = 419

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D     +FVG + +E ++E L+  FS  G V+   ++ + ESG+ +GFGF  + D     
Sbjct: 12  DKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETAL 71

Query: 254 LVLQN-GPHQLDGRTI 298
             ++N   +++ GRT+
Sbjct: 72  SAMRNLNGYEIGGRTL 87


>AE014297-2555|AAF55577.2|  419|Drosophila melanogaster CG7697-PA
           protein.
          Length = 419

 Score = 50.4 bits (115), Expect = 2e-06
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D     +FVG + +E ++E L+  FS  G V+   ++ + ESG+ +GFGF  + D     
Sbjct: 12  DKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETAL 71

Query: 254 LVLQN-GPHQLDGRTI 298
             ++N   +++ GRT+
Sbjct: 72  SAMRNLNGYEIGGRTL 87


>AY070612-1|AAL48083.1|  470|Drosophila melanogaster RE71384p
           protein.
          Length = 470

 Score = 48.4 bits (110), Expect(2) = 3e-06
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 3/112 (2%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  D      +FVG LS E   E L+  F+ +GE+ +C ++++  + +S+G+ FV+F   
Sbjct: 87  PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKK 146

Query: 242 SLVNLVLQNGPHQLDGRTIDPKPCNPRTL---QKPKRGGGYPKVFLGGLPSN 388
           +     +Q    Q  G        + R L   ++P +GGG     +GG P N
Sbjct: 147 AEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGG-GMGGGPGN 197



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMK 187
           MD+ +   L+VG L    S++ L   FS  G V  C +++
Sbjct: 1   MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIR 40



 Score = 21.0 bits (42), Expect(2) = 3e-06
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 362 VFLGGLPSNVTETDL 406
           V+ GG P NV   DL
Sbjct: 223 VYCGGFPPNVISDDL 237


>AE014297-3445|AAN13978.1|  470|Drosophila melanogaster CG5422-PD,
           isoform D protein.
          Length = 470

 Score = 48.4 bits (110), Expect(2) = 3e-06
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 3/112 (2%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  D      +FVG LS E   E L+  F+ +GE+ +C ++++  + +S+G+ FV+F   
Sbjct: 87  PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKK 146

Query: 242 SLVNLVLQNGPHQLDGRTIDPKPCNPRTL---QKPKRGGGYPKVFLGGLPSN 388
           +     +Q    Q  G        + R L   ++P +GGG     +GG P N
Sbjct: 147 AEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGG-GMGGGPGN 197



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMK 187
           MD+ +   L+VG L    S++ L   FS  G V  C +++
Sbjct: 1   MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIR 40



 Score = 21.0 bits (42), Expect(2) = 3e-06
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 362 VFLGGLPSNVTETDL 406
           V+ GG P NV   DL
Sbjct: 223 VYCGGFPPNVISDDL 237


>AE014297-3444|AAN13977.1|  464|Drosophila melanogaster CG5422-PF,
           isoform F protein.
          Length = 464

 Score = 48.4 bits (110), Expect(2) = 3e-06
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 3/112 (2%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  D      +FVG LS E   E L+  F+ +GE+ +C ++++  + +S+G+ FV+F   
Sbjct: 87  PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKK 146

Query: 242 SLVNLVLQNGPHQLDGRTIDPKPCNPRTL---QKPKRGGGYPKVFLGGLPSN 388
           +     +Q    Q  G        + R L   ++P +GGG     +GG P N
Sbjct: 147 AEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGG-GMGGGPGN 197



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMK 187
           MD+ +   L+VG L    S++ L   FS  G V  C +++
Sbjct: 1   MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIR 40



 Score = 21.0 bits (42), Expect(2) = 3e-06
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 362 VFLGGLPSNVTETDL 406
           V+ GG P NV   DL
Sbjct: 223 VYCGGFPPNVISDDL 237


>AE014297-3443|AAF56224.1|  464|Drosophila melanogaster CG5422-PC,
           isoform C protein.
          Length = 464

 Score = 48.4 bits (110), Expect(2) = 3e-06
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 3/112 (2%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  D      +FVG LS E   E L+  F+ +GE+ +C ++++  + +S+G+ FV+F   
Sbjct: 87  PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKK 146

Query: 242 SLVNLVLQNGPHQLDGRTIDPKPCNPRTL---QKPKRGGGYPKVFLGGLPSN 388
           +     +Q    Q  G        + R L   ++P +GGG     +GG P N
Sbjct: 147 AEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGG-GMGGGPGN 197



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMK 187
           MD+ +   L+VG L    S++ L   FS  G V  C +++
Sbjct: 1   MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIR 40



 Score = 21.0 bits (42), Expect(2) = 3e-06
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 362 VFLGGLPSNVTETDL 406
           V+ GG P NV   DL
Sbjct: 223 VYCGGFPPNVISDDL 237


>AE014297-3442|AAF56225.1|  464|Drosophila melanogaster CG5422-PB,
           isoform B protein.
          Length = 464

 Score = 48.4 bits (110), Expect(2) = 3e-06
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 3/112 (2%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  D      +FVG LS E   E L+  F+ +GE+ +C ++++  + +S+G+ FV+F   
Sbjct: 87  PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKK 146

Query: 242 SLVNLVLQNGPHQLDGRTIDPKPCNPRTL---QKPKRGGGYPKVFLGGLPSN 388
           +     +Q    Q  G        + R L   ++P +GGG     +GG P N
Sbjct: 147 AEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGG-GMGGGPGN 197



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMK 187
           MD+ +   L+VG L    S++ L   FS  G V  C +++
Sbjct: 1   MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIR 40



 Score = 21.0 bits (42), Expect(2) = 3e-06
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 362 VFLGGLPSNVTETDL 406
           V+ GG P NV   DL
Sbjct: 223 VYCGGFPPNVISDDL 237


>L13038-1|AAA02941.1|  465|Drosophila melanogaster
           polyadenylate-binding protein protein.
          Length = 465

 Score = 47.6 bits (108), Expect(2) = 4e-06
 Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 4/113 (3%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  D      +FVG LS E   E L+  F+ +GE+ +C ++++  + +S+G+ FV+F   
Sbjct: 87  PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKK 146

Query: 242 SLVNLVLQNGPHQ-LDGRTIDPKPCNPRTL---QKPKRGGGYPKVFLGGLPSN 388
           +     +Q    Q +  R+I     + R L   ++P +GGG     +GG P N
Sbjct: 147 AEAENAIQAMNRQWIASRSIRTN-WSTRKLPPPREPSKGGGQGG-GMGGGPGN 197



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMK 187
           MD+ +   L+VG L    S++ L   FS  G V  C +++
Sbjct: 1   MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIR 40



 Score = 21.0 bits (42), Expect(2) = 4e-06
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 362 VFLGGLPSNVTETDL 406
           V+ GG P NV   DL
Sbjct: 223 VYCGGFPPNVISDDL 237


>L13037-1|AAA28828.1|  465|Drosophila melanogaster
           polyadenylate-binding protein protein.
          Length = 465

 Score = 47.6 bits (108), Expect(2) = 4e-06
 Identities = 33/113 (29%), Positives = 57/113 (50%), Gaps = 4/113 (3%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  D      +FVG LS E   E L+  F+ +GE+ +C ++++  + +S+G+ FV+F   
Sbjct: 87  PKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKK 146

Query: 242 SLVNLVLQNGPHQ-LDGRTIDPKPCNPRTL---QKPKRGGGYPKVFLGGLPSN 388
           +     +Q    Q +  R+I     + R L   ++P +GGG     +GG P N
Sbjct: 147 AEAENAIQAMNRQWIASRSIRTN-WSTRKLPPPREPSKGGGQGG-GMGGGPGN 197



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 13/40 (32%), Positives = 21/40 (52%)
 Frame = +2

Query: 68  MDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMK 187
           MD+ +   L+VG L    S++ L   FS  G V  C +++
Sbjct: 1   MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIR 40



 Score = 21.0 bits (42), Expect(2) = 4e-06
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +2

Query: 362 VFLGGLPSNVTETDL 406
           V+ GG P NV   DL
Sbjct: 223 VYCGGFPPNVISDDL 237


>AY121663-1|AAM51990.1|  505|Drosophila melanogaster RE10833p
           protein.
          Length = 505

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 21/55 (38%), Positives = 37/55 (67%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           E+  +FVG LS E   + L+  F+ +GE+ DC V+++ ++ +S+G+GFV+F   S
Sbjct: 164 EQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKS 218


>AE014297-4216|AAF56774.2|  505|Drosophila melanogaster CG12870-PA
           protein.
          Length = 505

 Score = 48.8 bits (111), Expect = 5e-06
 Identities = 21/55 (38%), Positives = 37/55 (67%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           E+  +FVG LS E   + L+  F+ +GE+ DC V+++ ++ +S+G+GFV+F   S
Sbjct: 164 EQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKS 218


>BT025832-1|ABF85732.1|  791|Drosophila melanogaster IP09238p
           protein.
          Length = 791

 Score = 48.0 bits (109), Expect = 9e-06
 Identities = 20/51 (39%), Positives = 35/51 (68%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           +FVG LS E   + L+  F+ +GE+ DC V+++ ++ +S+G+GFV+F   S
Sbjct: 454 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKS 504


>AY069584-1|AAL39729.1|  195|Drosophila melanogaster LD32469p
           protein.
          Length = 195

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 7/94 (7%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ-N 268
           L V  L++ T+ E+L+R F R GEV D  + ++  +  SRGF FV F D       L+  
Sbjct: 25  LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAM 84

Query: 269 GPHQLDGRTID------PKPCNPRTLQKPKRGGG 352
               LDGR +        +P +P      +RGGG
Sbjct: 85  DGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGG 118


>AF232775-1|AAF43415.1|  195|Drosophila melanogaster SR family
           splicing factor SC35 protein.
          Length = 195

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 7/94 (7%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ-N 268
           L V  L++ T+ E+L+R F R GEV D  + ++  +  SRGF FV F D       L+  
Sbjct: 25  LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAM 84

Query: 269 GPHQLDGRTID------PKPCNPRTLQKPKRGGG 352
               LDGR +        +P +P      +RGGG
Sbjct: 85  DGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGG 118


>AE014134-2203|AAF53192.1|  195|Drosophila melanogaster CG5442-PB,
           isoform B protein.
          Length = 195

 Score = 47.2 bits (107), Expect = 2e-05
 Identities = 32/94 (34%), Positives = 46/94 (48%), Gaps = 7/94 (7%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ-N 268
           L V  L++ T+ E+L+R F R GEV D  + ++  +  SRGF FV F D       L+  
Sbjct: 25  LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAM 84

Query: 269 GPHQLDGRTID------PKPCNPRTLQKPKRGGG 352
               LDGR +        +P +P      +RGGG
Sbjct: 85  DGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGG 118


>AY118842-1|AAM50702.1|  435|Drosophila melanogaster GM13065p
           protein.
          Length = 435

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 25/77 (32%), Positives = 39/77 (50%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D D K  +FVG L +  ++E L+  FS  GE+     +++ + G  +G  +V F  P  V
Sbjct: 255 DKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAV 313

Query: 251 NLVLQNGPHQLDGRTID 301
            L L+     LD R I+
Sbjct: 314 GLALELNQTLLDDRPIN 330


>AE014134-2808|AAF53587.1|  435|Drosophila melanogaster CG12288-PA
           protein.
          Length = 435

 Score = 46.4 bits (105), Expect = 3e-05
 Identities = 25/77 (32%), Positives = 39/77 (50%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLV 250
           D D K  +FVG L +  ++E L+  FS  GE+     +++ + G  +G  +V F  P  V
Sbjct: 255 DKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKPDAV 313

Query: 251 NLVLQNGPHQLDGRTID 301
            L L+     LD R I+
Sbjct: 314 GLALELNQTLLDDRPIN 330


>U51858-1|AAC47133.1|  228|Drosophila melanogaster boule protein
           protein.
          Length = 228

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 34/48 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++FVGG+S +T++ +L R FS YG V    ++ +  +G S+G+GFVTF
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTF 80


>BT011495-1|AAR99153.1|   95|Drosophila melanogaster GH12029p
           protein.
          Length = 95

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 34/48 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++FVGG+S +T++ +L R FS YG V    ++ +  +G S+G+GFVTF
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTF 80


>AY060413-1|AAL25452.1|  307|Drosophila melanogaster LD36772p
           protein.
          Length = 307

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 27/114 (23%), Positives = 53/114 (46%), Gaps = 1/114 (0%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GK+++  L      + +   FS +G +++C V K+ E G SRG+GFV F         
Sbjct: 111 DSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGYGFVHFDSEEAARAA 169

Query: 260 LQNGPHQL-DGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           ++     L + + +      PR  ++ ++   +  +++  L    TE  LR +F
Sbjct: 170 IEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMF 223



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L+V  LS E ++++L+  F  YG +    +M + E GRSR FGFV + +P
Sbjct: 205 LYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENP 253


>AE014296-1589|AAN11987.1|  189|Drosophila melanogaster CG4760-PC,
           isoform C protein.
          Length = 189

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 34/48 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++FVGG+S +T++ +L R FS YG V    ++ +  +G S+G+GFVTF
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTF 80


>AE014296-1588|AAF50316.3|  189|Drosophila melanogaster CG4760-PA,
           isoform A protein.
          Length = 189

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 34/48 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++FVGG+S +T++ +L R FS YG V    ++ +  +G S+G+GFVTF
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTF 80


>AE014296-1587|AAN11986.1|  228|Drosophila melanogaster CG4760-PD,
           isoform D protein.
          Length = 228

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 34/48 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++FVGG+S +T++ +L R FS YG V    ++ +  +G S+G+GFVTF
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTF 80


>AE014296-1586|AAF50317.3|  228|Drosophila melanogaster CG4760-PB,
           isoform B protein.
          Length = 228

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 34/48 (70%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++FVGG+S +T++ +L R FS YG V    ++ +  +G S+G+GFVTF
Sbjct: 34  RIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVD-RAGVSKGYGFVTF 80


>AE013599-3890|AAF47219.1|  307|Drosophila melanogaster CG4612-PA
           protein.
          Length = 307

 Score = 46.0 bits (104), Expect = 4e-05
 Identities = 27/114 (23%), Positives = 53/114 (46%), Gaps = 1/114 (0%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLV 259
           + GK+++  L      + +   FS +G +++C V K+ E G SRG+GFV F         
Sbjct: 111 DSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGYGFVHFDSEEAARAA 169

Query: 260 LQNGPHQL-DGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           ++     L + + +      PR  ++ ++   +  +++  L    TE  LR +F
Sbjct: 170 IEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMF 223



 Score = 40.3 bits (90), Expect = 0.002
 Identities = 20/50 (40%), Positives = 31/50 (62%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           L+V  LS E ++++L+  F  YG +    +M + E GRSR FGFV + +P
Sbjct: 205 LYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENP 253


>U73846-1|AAB61993.1|  808|Drosophila melanogaster testis-specific
           RNP-type RNA bindingprotein protein.
          Length = 808

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 21/63 (33%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLFVG L+ + ++ ++++ F  +G + +C V+++ ++G+S+G  FV
Sbjct: 429 IQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRD-QNGQSKGCAFV 487

Query: 227 TFA 235
           TFA
Sbjct: 488 TFA 490



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 31/115 (26%), Positives = 49/115 (42%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVG +     +  L+  F  YG V    V+++  +G S+G  FVTF       
Sbjct: 351 DPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRRAA- 409

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           L  Q+  H +        P   +      R     K+F+G L   + E D+R +F
Sbjct: 410 LKAQDALHNVKTLNGMYHPIQMKPADSENR--NERKLFVGMLNKKLNENDVRKLF 462


>U58976-1|AAB58464.1|  604|Drosophila melanogaster bruno protein.
          Length = 604

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 21/63 (33%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLFVG L+ + ++ ++++ F  +G + +C V+++ ++G+S+G  FV
Sbjct: 225 IQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRD-QNGQSKGCAFV 283

Query: 227 TFA 235
           TFA
Sbjct: 284 TFA 286



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 31/115 (26%), Positives = 49/115 (42%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVG +     +  L+  F  YG V    V+++  +G S+G  FVTF       
Sbjct: 147 DPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRRAA- 205

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           L  Q+  H +        P   +      R     K+F+G L   + E D+R +F
Sbjct: 206 LKAQDALHNVKTLNGMYHPIQMKPADSENR--NERKLFVGMLNKKLNENDVRKLF 258


>AY071420-1|AAL49042.1|  302|Drosophila melanogaster RE50009p
           protein.
          Length = 302

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 23/82 (28%), Positives = 46/82 (56%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  ++F G L  + + E L R F+++       V+++  +G+S+GFGFV+F +P+    
Sbjct: 195 DDDFRIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIR 254

Query: 257 VLQNGPHQLDGRTIDPKPCNPR 322
            ++    ++DGR +  +P   R
Sbjct: 255 AMK----EMDGRYVGSRPIKLR 272


>AY051758-1|AAK93182.1|  604|Drosophila melanogaster LD29068p
           protein.
          Length = 604

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 21/63 (33%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLFVG L+ + ++ ++++ F  +G + +C V+++ ++G+S+G  FV
Sbjct: 225 IQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRD-QNGQSKGCAFV 283

Query: 227 TFA 235
           TFA
Sbjct: 284 TFA 286



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 31/115 (26%), Positives = 49/115 (42%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVG +     +  L+  F  YG V    V+++  +G S+G  FVTF       
Sbjct: 147 DPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAA- 205

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           L  Q+  H +        P   +      R     K+F+G L   + E D+R +F
Sbjct: 206 LKAQDALHNVKTLNGMYHPIQMKPADSENR--NERKLFVGMLNKKLNENDVRKLF 258


>AE014297-279|AAF52006.1|  302|Drosophila melanogaster CG2931-PA
           protein.
          Length = 302

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 23/82 (28%), Positives = 46/82 (56%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           D+  ++F G L  + + E L R F+++       V+++  +G+S+GFGFV+F +P+    
Sbjct: 195 DDDFRIFCGDLGNDVNDEVLTRTFNKFPSFQRARVVRDKRTGKSKGFGFVSFREPADFIR 254

Query: 257 VLQNGPHQLDGRTIDPKPCNPR 322
            ++    ++DGR +  +P   R
Sbjct: 255 AMK----EMDGRYVGSRPIKLR 272


>AE014134-2183|AAN10812.1|  604|Drosophila melanogaster CG31762-PA,
           isoform A protein.
          Length = 604

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 21/63 (33%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLFVG L+ + ++ ++++ F  +G + +C V+++ ++G+S+G  FV
Sbjct: 225 IQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRD-QNGQSKGCAFV 283

Query: 227 TFA 235
           TFA
Sbjct: 284 TFA 286



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 31/115 (26%), Positives = 49/115 (42%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVG +     +  L+  F  YG V    V+++  +G S+G  FVTF       
Sbjct: 147 DPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAA- 205

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           L  Q+  H +        P   +      R     K+F+G L   + E D+R +F
Sbjct: 206 LKAQDALHNVKTLNGMYHPIQMKPADSENR--NERKLFVGMLNKKLNENDVRKLF 258


>AE014134-2182|AAN10811.1|  616|Drosophila melanogaster CG31762-PC,
           isoform C protein.
          Length = 616

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 21/63 (33%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLFVG L+ + ++ ++++ F  +G + +C V+++ ++G+S+G  FV
Sbjct: 225 IQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRD-QNGQSKGCAFV 283

Query: 227 TFA 235
           TFA
Sbjct: 284 TFA 286



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 31/115 (26%), Positives = 49/115 (42%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVG +     +  L+  F  YG V    V+++  +G S+G  FVTF       
Sbjct: 147 DPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAA- 205

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           L  Q+  H +        P   +      R     K+F+G L   + E D+R +F
Sbjct: 206 LKAQDALHNVKTLNGMYHPIQMKPADSENR--NERKLFVGMLNKKLNENDVRKLF 258


>AE014134-2181|AAN10810.1|  810|Drosophila melanogaster CG31762-PB,
           isoform B protein.
          Length = 810

 Score = 45.6 bits (103), Expect = 5e-05
 Identities = 21/63 (33%), Positives = 44/63 (69%), Gaps = 1/63 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLFVG L+ + ++ ++++ F  +G + +C V+++ ++G+S+G  FV
Sbjct: 431 IQMKPADSENRNERKLFVGMLNKKLNENDVRKLFEVHGAIEECTVLRD-QNGQSKGCAFV 489

Query: 227 TFA 235
           TFA
Sbjct: 490 TFA 492



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 31/115 (26%), Positives = 49/115 (42%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D +  K+FVG +     +  L+  F  YG V    V+++  +G S+G  FVTF       
Sbjct: 353 DPDNIKMFVGQVPKSMDESQLREMFEEYGAVHSINVLRDKATGISKGCCFVTFYTRHAA- 411

Query: 254 LVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           L  Q+  H +        P   +      R     K+F+G L   + E D+R +F
Sbjct: 412 LKAQDALHNVKTLNGMYHPIQMKPADSENR--NERKLFVGMLNKKLNENDVRKLF 464


>AY069464-1|AAL39609.1|  632|Drosophila melanogaster LD19052p
           protein.
          Length = 632

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 21/63 (33%), Positives = 45/63 (71%), Gaps = 1/63 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLFVG L+ + ++ ++++ F+ +G + +C V+++ ++G+S+G  FV
Sbjct: 369 IQMKPADSENRNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFV 427

Query: 227 TFA 235
           TFA
Sbjct: 428 TFA 430



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 34/126 (26%), Positives = 56/126 (44%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D  D +  K+FVG +     +  L++ F ++G V    V+++  +  SRG  FVT+    
Sbjct: 288 DQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRK 347

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
              L  Q+  H +  +T+D      +            K+F+G L    TE D+R +F  
Sbjct: 348 AA-LRAQDALHNI--KTLDGMHHPIQMKPADSENRNERKLFVGMLNKKYTEADVRQLF-- 402

Query: 425 LWEGHG 442
              GHG
Sbjct: 403 --TGHG 406


>AE014134-3163|AAF53845.1|  154|Drosophila melanogaster CG10466-PA
           protein.
          Length = 154

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 19/59 (32%), Positives = 38/59 (64%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV G  +  ++ +L   FS+YGEV++  ++++S++G+S+GF F+ + D     L + N
Sbjct: 36  IFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDN 94



 Score = 31.9 bits (69), Expect = 0.66
 Identities = 17/50 (34%), Positives = 27/50 (54%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDEXS 518
           +AG   TL +      F +YG+V+ + ++ D    KS G  FL +ED+ S
Sbjct: 38  VAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRS 87


>AE014134-2189|AAF53180.3|  632|Drosophila melanogaster CG31761-PC,
           isoform C protein.
          Length = 632

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 21/63 (33%), Positives = 45/63 (71%), Gaps = 1/63 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLFVG L+ + ++ ++++ F+ +G + +C V+++ ++G+S+G  FV
Sbjct: 369 IQMKPADSENRNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFV 427

Query: 227 TFA 235
           TFA
Sbjct: 428 TFA 430



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 34/126 (26%), Positives = 56/126 (44%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D  D +  K+FVG +     +  L++ F ++G V    V+++  +  SRG  FVT+    
Sbjct: 288 DQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRK 347

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
              L  Q+  H +  +T+D      +            K+F+G L    TE D+R +F  
Sbjct: 348 AA-LRAQDALHNI--KTLDGMHHPIQMKPADSENRNERKLFVGMLNKKYTEADVRQLF-- 402

Query: 425 LWEGHG 442
              GHG
Sbjct: 403 --TGHG 406


>AE014134-2188|AAF53181.2|  632|Drosophila melanogaster CG31761-PA,
           isoform A protein.
          Length = 632

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 21/63 (33%), Positives = 45/63 (71%), Gaps = 1/63 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLFVG L+ + ++ ++++ F+ +G + +C V+++ ++G+S+G  FV
Sbjct: 369 IQMKPADSENRNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFV 427

Query: 227 TFA 235
           TFA
Sbjct: 428 TFA 430



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 34/126 (26%), Positives = 56/126 (44%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D  D +  K+FVG +     +  L++ F ++G V    V+++  +  SRG  FVT+    
Sbjct: 288 DQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRK 347

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
              L  Q+  H +  +T+D      +            K+F+G L    TE D+R +F  
Sbjct: 348 AA-LRAQDALHNI--KTLDGMHHPIQMKPADSENRNERKLFVGMLNKKYTEADVRQLF-- 402

Query: 425 LWEGHG 442
              GHG
Sbjct: 403 --TGHG 406


>AE014134-2187|AAO41184.1|  737|Drosophila melanogaster CG31761-PD,
           isoform D protein.
          Length = 737

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 21/63 (33%), Positives = 45/63 (71%), Gaps = 1/63 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLFVG L+ + ++ ++++ F+ +G + +C V+++ ++G+S+G  FV
Sbjct: 369 IQMKPADSENRNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFV 427

Query: 227 TFA 235
           TFA
Sbjct: 428 TFA 430



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 34/126 (26%), Positives = 56/126 (44%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D  D +  K+FVG +     +  L++ F ++G V    V+++  +  SRG  FVT+    
Sbjct: 288 DQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRK 347

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
              L  Q+  H +  +T+D      +            K+F+G L    TE D+R +F  
Sbjct: 348 AA-LRAQDALHNI--KTLDGMHHPIQMKPADSENRNERKLFVGMLNKKYTEADVRQLF-- 402

Query: 425 LWEGHG 442
              GHG
Sbjct: 403 --TGHG 406


>AE014134-2186|ABI31310.1|  893|Drosophila melanogaster CG31761-PE,
           isoform E protein.
          Length = 893

 Score = 45.2 bits (102), Expect = 7e-05
 Identities = 21/63 (33%), Positives = 45/63 (71%), Gaps = 1/63 (1%)
 Frame = +2

Query: 50  MRMNP-DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           ++M P D ++  + KLFVG L+ + ++ ++++ F+ +G + +C V+++ ++G+S+G  FV
Sbjct: 369 IQMKPADSENRNERKLFVGMLNKKYTEADVRQLFTGHGTIEECTVLRD-QAGQSKGCAFV 427

Query: 227 TFA 235
           TFA
Sbjct: 428 TFA 430



 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 34/126 (26%), Positives = 56/126 (44%)
 Frame = +2

Query: 65  DMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPS 244
           D  D +  K+FVG +     +  L++ F ++G V    V+++  +  SRG  FVT+    
Sbjct: 288 DQPDADNIKMFVGQIPKTWDETRLRQMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRK 347

Query: 245 LVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
              L  Q+  H +  +T+D      +            K+F+G L    TE D+R +F  
Sbjct: 348 AA-LRAQDALHNI--KTLDGMHHPIQMKPADSENRNERKLFVGMLNKKYTEADVRQLF-- 402

Query: 425 LWEGHG 442
              GHG
Sbjct: 403 --TGHG 406


>M31162-1|AAA28859.1|  448|Drosophila melanogaster protein (
           D.melanogaster U1 70Ksmall nuclear ribonucleoprotein
           gene, complete cds. ).
          Length = 448

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 21/78 (26%), Positives = 43/78 (55%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D    LF+  ++++TS+  L+R F  YG +   V++ + ESG+ +G+ F+ +     ++
Sbjct: 98  EDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMH 157

Query: 254 LVLQNGPHQLDGRTIDPK 307
              ++     DG+ ID K
Sbjct: 158 AAYKHA----DGKKIDSK 171



 Score = 29.9 bits (64), Expect = 2.7
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  YG + ++V+++DQ   K  G  F+ +E E
Sbjct: 122 FEFYGPIKKIVLIHDQESGKPKGYAFIEYEHE 153


>BT011006-1|AAR27877.1|  690|Drosophila melanogaster AT27578p
           protein.
          Length = 690

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG------FGFVTFADPSLV 250
           +LF+G +    S+++L+  FSR+G V++  ++  + +    G      +GF+T+ DP  V
Sbjct: 494 QLFLGNIPHHASEDDLREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAV 553

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
              L N P      + D +  N    +   R    P+  +GG
Sbjct: 554 QKCLANCPLYFPENSPDGQKLNVEEKKPRVRNDMVPRQQIGG 595


>AY089622-1|AAL90360.1|  448|Drosophila melanogaster RE35772p
           protein.
          Length = 448

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 21/78 (26%), Positives = 43/78 (55%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D    LF+  ++++TS+  L+R F  YG +   V++ + ESG+ +G+ F+ +     ++
Sbjct: 98  EDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMH 157

Query: 254 LVLQNGPHQLDGRTIDPK 307
              ++     DG+ ID K
Sbjct: 158 AAYKHA----DGKKIDSK 171



 Score = 29.9 bits (64), Expect = 2.7
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  YG + ++V+++DQ   K  G  F+ +E E
Sbjct: 122 FEFYGPIKKIVLIHDQESGKPKGYAFIEYEHE 153


>AY061501-1|AAL29049.1|  448|Drosophila melanogaster LD46049p
           protein.
          Length = 448

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 21/78 (26%), Positives = 43/78 (55%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D    LF+  ++++TS+  L+R F  YG +   V++ + ESG+ +G+ F+ +     ++
Sbjct: 98  EDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMH 157

Query: 254 LVLQNGPHQLDGRTIDPK 307
              ++     DG+ ID K
Sbjct: 158 AAYKHA----DGKKIDSK 171



 Score = 29.9 bits (64), Expect = 2.7
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  YG + ++V+++DQ   K  G  F+ +E E
Sbjct: 122 FEFYGPIKKIVLIHDQESGKPKGYAFIEYEHE 153


>AY058617-1|AAL13846.1|  690|Drosophila melanogaster LD31194p
           protein.
          Length = 690

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG------FGFVTFADPSLV 250
           +LF+G +    S+++L+  FSR+G V++  ++  + +    G      +GF+T+ DP  V
Sbjct: 494 QLFLGNIPHHASEDDLREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAV 553

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
              L N P      + D +  N    +   R    P+  +GG
Sbjct: 554 QKCLANCPLYFPENSPDGQKLNVEEKKPRVRNDMVPRQQIGG 595


>AF231031-1|AAF68949.1|  690|Drosophila melanogaster rasputin
           protein.
          Length = 690

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG------FGFVTFADPSLV 250
           +LF+G +    S+++L+  FSR+G V++  ++  + +    G      +GF+T+ DP  V
Sbjct: 494 QLFLGNIPHHASEDDLREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAV 553

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
              L N P      + D +  N    +   R    P+  +GG
Sbjct: 554 QKCLANCPLYFPENSPDGQKLNVEEKKPRVRNDMVPRQQIGG 595


>AE014297-1713|AAN13573.1|  690|Drosophila melanogaster CG9412-PE,
           isoform E protein.
          Length = 690

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG------FGFVTFADPSLV 250
           +LF+G +    S+++L+  FSR+G V++  ++  + +    G      +GF+T+ DP  V
Sbjct: 494 QLFLGNIPHHASEDDLREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAV 553

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
              L N P      + D +  N    +   R    P+  +GG
Sbjct: 554 QKCLANCPLYFPENSPDGQKLNVEEKKPRVRNDMVPRQQIGG 595


>AE014297-1712|AAN13572.1|  690|Drosophila melanogaster CG9412-PD,
           isoform D protein.
          Length = 690

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG------FGFVTFADPSLV 250
           +LF+G +    S+++L+  FSR+G V++  ++  + +    G      +GF+T+ DP  V
Sbjct: 494 QLFLGNIPHHASEDDLREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAV 553

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
              L N P      + D +  N    +   R    P+  +GG
Sbjct: 554 QKCLANCPLYFPENSPDGQKLNVEEKKPRVRNDMVPRQQIGG 595


>AE014297-1711|AAN13571.1|  690|Drosophila melanogaster CG9412-PC,
           isoform C protein.
          Length = 690

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG------FGFVTFADPSLV 250
           +LF+G +    S+++L+  FSR+G V++  ++  + +    G      +GF+T+ DP  V
Sbjct: 494 QLFLGNIPHHASEDDLREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAV 553

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
              L N P      + D +  N    +   R    P+  +GG
Sbjct: 554 QKCLANCPLYFPENSPDGQKLNVEEKKPRVRNDMVPRQQIGG 595


>AE014297-1710|AAG22151.2|  690|Drosophila melanogaster CG9412-PB,
           isoform B protein.
          Length = 690

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG------FGFVTFADPSLV 250
           +LF+G +    S+++L+  FSR+G V++  ++  + +    G      +GF+T+ DP  V
Sbjct: 494 QLFLGNIPHHASEDDLREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAV 553

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
              L N P      + D +  N    +   R    P+  +GG
Sbjct: 554 QKCLANCPLYFPENSPDGQKLNVEEKKPRVRNDMVPRQQIGG 595


>AE014297-1709|AAF54965.3|  690|Drosophila melanogaster CG9412-PA,
           isoform A protein.
          Length = 690

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRG------FGFVTFADPSLV 250
           +LF+G +    S+++L+  FSR+G V++  ++  + +    G      +GF+T+ DP  V
Sbjct: 494 QLFLGNIPHHASEDDLREIFSRFGNVLELRILSKAGNKVPPGMRSPLNYGFITYDDPEAV 553

Query: 251 NLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGG 376
              L N P      + D +  N    +   R    P+  +GG
Sbjct: 554 QKCLANCPLYFPENSPDGQKLNVEEKKPRVRNDMVPRQQIGG 595


>AE014134-1210|AAF52471.1|  448|Drosophila melanogaster CG8749-PA
           protein.
          Length = 448

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 21/78 (26%), Positives = 43/78 (55%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           +D    LF+  ++++TS+  L+R F  YG +   V++ + ESG+ +G+ F+ +     ++
Sbjct: 98  EDPFRTLFIARINYDTSESKLRREFEFYGPIKKIVLIHDQESGKPKGYAFIEYEHERDMH 157

Query: 254 LVLQNGPHQLDGRTIDPK 307
              ++     DG+ ID K
Sbjct: 158 AAYKHA----DGKKIDSK 171



 Score = 29.9 bits (64), Expect = 2.7
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +3

Query: 417 FGRYGKVMEVVIMYDQXKKKSXGXGFLSFEDE 512
           F  YG + ++V+++DQ   K  G  F+ +E E
Sbjct: 122 FEFYGPIKKIVLIHDQESGKPKGYAFIEYEHE 153


>AY051860-1|AAK93284.1|  594|Drosophila melanogaster LD35730p
           protein.
          Length = 594

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           +L+VG L +  +++ L+  F  +G++    ++ ++E+GRS+G+GF+T+  AD +   L  
Sbjct: 336 RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQ 395

Query: 263 QNGPHQLDGR 292
            NG  +L GR
Sbjct: 396 LNG-FELAGR 404



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 8/112 (7%)
 Frame = +2

Query: 107 LSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLD 286
           LS      +L+ +FS  G+V D  ++  +++ R +G  ++ F DP  V L L     +L 
Sbjct: 244 LSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESVALALGLSGQRLL 303

Query: 287 GRTI--DPKPCNPRTLQ------KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           G  I           LQ      +PK   G  ++++G L  N+TE  LR IF
Sbjct: 304 GVPIMVQHTQAEKNRLQNAAPAFQPKSHTGPMRLYVGSLHFNITEDMLRGIF 355


>AE014134-1228|AAN10619.1|  287|Drosophila melanogaster CG11266-PG,
           isoform G protein.
          Length = 287

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           +L+VG L +  +++ L+  F  +G++    ++ ++E+GRS+G+GF+T+  AD +   L  
Sbjct: 29  RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQ 88

Query: 263 QNGPHQLDGR 292
            NG  +L GR
Sbjct: 89  LNG-FELAGR 97


>AE014134-1227|AAN10618.1|  287|Drosophila melanogaster CG11266-PF,
           isoform F protein.
          Length = 287

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           +L+VG L +  +++ L+  F  +G++    ++ ++E+GRS+G+GF+T+  AD +   L  
Sbjct: 29  RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQ 88

Query: 263 QNGPHQLDGR 292
            NG  +L GR
Sbjct: 89  LNG-FELAGR 97


>AE014134-1226|AAN10615.2|  287|Drosophila melanogaster CG11266-PE,
           isoform E protein.
          Length = 287

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           +L+VG L +  +++ L+  F  +G++    ++ ++E+GRS+G+GF+T+  AD +   L  
Sbjct: 29  RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQ 88

Query: 263 QNGPHQLDGR 292
            NG  +L GR
Sbjct: 89  LNG-FELAGR 97


>AE014134-1225|AAN10617.1|  287|Drosophila melanogaster CG11266-PD,
           isoform D protein.
          Length = 287

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           +L+VG L +  +++ L+  F  +G++    ++ ++E+GRS+G+GF+T+  AD +   L  
Sbjct: 29  RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQ 88

Query: 263 QNGPHQLDGR 292
            NG  +L GR
Sbjct: 89  LNG-FELAGR 97


>AE014134-1224|AAN10616.1|  287|Drosophila melanogaster CG11266-PC,
           isoform C protein.
          Length = 287

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           +L+VG L +  +++ L+  F  +G++    ++ ++E+GRS+G+GF+T+  AD +   L  
Sbjct: 29  RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQ 88

Query: 263 QNGPHQLDGR 292
            NG  +L GR
Sbjct: 89  LNG-FELAGR 97


>AE014134-1223|AAN10614.1|  594|Drosophila melanogaster CG11266-PB,
           isoform B protein.
          Length = 594

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           +L+VG L +  +++ L+  F  +G++    ++ ++E+GRS+G+GF+T+  AD +   L  
Sbjct: 336 RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQ 395

Query: 263 QNGPHQLDGR 292
            NG  +L GR
Sbjct: 396 LNG-FELAGR 404



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 8/112 (7%)
 Frame = +2

Query: 107 LSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLD 286
           LS      +L+ +FS  G+V D  ++  +++ R +G  ++ F DP  V L L     +L 
Sbjct: 244 LSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESVALALGLSGQRLL 303

Query: 287 GRTI--DPKPCNPRTLQ------KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           G  I           LQ      +PK   G  ++++G L  N+TE  LR IF
Sbjct: 304 GVPIMVQHTQAEKNRLQNAAPAFQPKSHTGPMRLYVGSLHFNITEDMLRGIF 355


>AE014134-1222|AAF52478.1|  594|Drosophila melanogaster CG11266-PA,
           isoform A protein.
          Length = 594

 Score = 43.6 bits (98), Expect = 2e-04
 Identities = 23/70 (32%), Positives = 44/70 (62%), Gaps = 2/70 (2%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF--ADPSLVNLVL 262
           +L+VG L +  +++ L+  F  +G++    ++ ++E+GRS+G+GF+T+  AD +   L  
Sbjct: 336 RLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNADDAKKALEQ 395

Query: 263 QNGPHQLDGR 292
            NG  +L GR
Sbjct: 396 LNG-FELAGR 404



 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 8/112 (7%)
 Frame = +2

Query: 107 LSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLD 286
           LS      +L+ +FS  G+V D  ++  +++ R +G  ++ F DP  V L L     +L 
Sbjct: 244 LSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKGIAYIEFDDPESVALALGLSGQRLL 303

Query: 287 GRTI--DPKPCNPRTLQ------KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
           G  I           LQ      +PK   G  ++++G L  N+TE  LR IF
Sbjct: 304 GVPIMVQHTQAEKNRLQNAAPAFQPKSHTGPMRLYVGSLHFNITEDMLRGIF 355


>AY061421-1|AAL28969.1|  300|Drosophila melanogaster LD35248p
           protein.
          Length = 300

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           ++K  ++VGGL+ E ++  L   F  +G++ D  +  + ES R RGF F+ +        
Sbjct: 3   NDKRTIYVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAA 62

Query: 257 VLQN-GPHQLDGRTI 298
            + N    +L GRTI
Sbjct: 63  AIDNMNDSELCGRTI 77


>AF182826-1|AAF01031.1|  300|Drosophila melanogaster cyclophilin-33
           protein.
          Length = 300

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           ++K  ++VGGL+ E ++  L   F  +G++ D  +  + ES R RGF F+ +        
Sbjct: 3   NDKRTIYVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAA 62

Query: 257 VLQN-GPHQLDGRTI 298
            + N    +L GRTI
Sbjct: 63  AIDNMNDSELCGRTI 77


>AE013599-2502|AAF57839.1|  300|Drosophila melanogaster CG4886-PA
           protein.
          Length = 300

 Score = 43.2 bits (97), Expect = 3e-04
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           ++K  ++VGGL+ E ++  L   F  +G++ D  +  + ES R RGF F+ +        
Sbjct: 3   NDKRTIYVGGLADEVTERLLNNAFIPFGDIADIQMPADYESQRHRGFAFIEYEQSEDAAA 62

Query: 257 VLQN-GPHQLDGRTI 298
            + N    +L GRTI
Sbjct: 63  AIDNMNDSELCGRTI 77


>L05109-1|AAA70421.1|  632|Drosophila melanogaster poly(A)-binding
           protein protein.
          Length = 632

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +2

Query: 80  EKGKLF----VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           EK KLF    V   + +   E L+ +F  YG++    VM + E G+S+GFGFV F     
Sbjct: 175 EKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVM-SKEDGKSKGFGFVAFETTEA 233

Query: 248 VNLVLQ--NGPHQLDGRTI 298
               +Q  NG    +G+++
Sbjct: 234 AEAAVQALNGKDMGEGKSL 252



 Score = 41.5 bits (93), Expect = 8e-04
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  L      + L+  FS YG +    VM + E GRS+GFGFV F   S     +   
Sbjct: 287 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNPESEATCAVT-- 343

Query: 272 PHQLDGRTIDPKP 310
             +L+GR +  KP
Sbjct: 344 --ELNGRVVGSKP 354



 Score = 39.5 bits (88), Expect = 0.003
 Identities = 40/153 (26%), Positives = 64/153 (41%), Gaps = 5/153 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +     G +F+  L      + +   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 81  DPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFET 139

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
               N  +   NG   L+G+ +      PR   K +  G   K+F      N TE     
Sbjct: 140 EEAANTSIDKVNG-MLLNGKKVYVGKFIPR---KEQELGEKAKLFTNVYVKNFTEDFDDE 195

Query: 413 IFRTLWEGHG--GGHYV*SXEE-KVXGFXILVF 502
             +  +E +G    + V S E+ K  GF  + F
Sbjct: 196 KLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAF 228


>AY118528-1|AAM49897.1|  634|Drosophila melanogaster LD24412p
           protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +2

Query: 80  EKGKLF----VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           EK KLF    V   + +   E L+ +F  YG++    VM + E G+S+GFGFV F     
Sbjct: 177 EKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVM-SKEDGKSKGFGFVAFETTEA 235

Query: 248 VNLVLQ--NGPHQLDGRTI 298
               +Q  NG    +G+++
Sbjct: 236 AEAAVQALNGKDMGEGKSL 254



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 5/153 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +     G +F+  L      + +   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 81  DPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFET 139

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
               N  +   NG   L+G+ +      PR  ++ K  G   K+F      N TE     
Sbjct: 140 EEAANTSIDKVNG-MLLNGKKVYVGKFIPRK-EREKELGEKAKLFTNVYVKNFTEDFDDE 197

Query: 413 IFRTLWEGHG--GGHYV*SXEE-KVXGFXILVF 502
             +  +E +G    + V S E+ K  GF  + F
Sbjct: 198 KLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAF 230



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  L      + L+  FS YG +    VM + E GRS+GFGFV F   S     +   
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNAASEATCAVT-- 345

Query: 272 PHQLDGRTIDPKP 310
             +L+GR +  KP
Sbjct: 346 --ELNGRVVGSKP 356


>AE013599-2628|AAS64811.1|  634|Drosophila melanogaster CG5119-PH,
           isoform H protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +2

Query: 80  EKGKLF----VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           EK KLF    V   + +   E L+ +F  YG++    VM + E G+S+GFGFV F     
Sbjct: 177 EKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVM-SKEDGKSKGFGFVAFETTEA 235

Query: 248 VNLVLQ--NGPHQLDGRTI 298
               +Q  NG    +G+++
Sbjct: 236 AEAAVQALNGKDMGEGKSL 254



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 5/153 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +     G +F+  L      + +   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 81  DPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFET 139

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
               N  +   NG   L+G+ +      PR  ++ K  G   K+F      N TE     
Sbjct: 140 EEAANTSIDKVNG-MLLNGKKVYVGKFIPRK-EREKELGEKAKLFTNVYVKNFTEDFDDE 197

Query: 413 IFRTLWEGHG--GGHYV*SXEE-KVXGFXILVF 502
             +  +E +G    + V S E+ K  GF  + F
Sbjct: 198 KLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAF 230



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  L      + L+  FS YG +    VM + E GRS+GFGFV F   S     +   
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNAASEATCAVT-- 345

Query: 272 PHQLDGRTIDPKP 310
             +L+GR +  KP
Sbjct: 346 --ELNGRVVGSKP 356


>AE013599-2627|AAM68178.1|  634|Drosophila melanogaster CG5119-PG,
           isoform G protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +2

Query: 80  EKGKLF----VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           EK KLF    V   + +   E L+ +F  YG++    VM + E G+S+GFGFV F     
Sbjct: 177 EKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVM-SKEDGKSKGFGFVAFETTEA 235

Query: 248 VNLVLQ--NGPHQLDGRTI 298
               +Q  NG    +G+++
Sbjct: 236 AEAAVQALNGKDMGEGKSL 254



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 5/153 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +     G +F+  L      + +   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 81  DPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFET 139

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
               N  +   NG   L+G+ +      PR  ++ K  G   K+F      N TE     
Sbjct: 140 EEAANTSIDKVNG-MLLNGKKVYVGKFIPRK-EREKELGEKAKLFTNVYVKNFTEDFDDE 197

Query: 413 IFRTLWEGHG--GGHYV*SXEE-KVXGFXILVF 502
             +  +E +G    + V S E+ K  GF  + F
Sbjct: 198 KLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAF 230



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  L      + L+  FS YG +    VM + E GRS+GFGFV F   S     +   
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNAASEATCAVT-- 345

Query: 272 PHQLDGRTIDPKP 310
             +L+GR +  KP
Sbjct: 346 --ELNGRVVGSKP 356


>AE013599-2626|AAF57747.1|  634|Drosophila melanogaster CG5119-PF,
           isoform F protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +2

Query: 80  EKGKLF----VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           EK KLF    V   + +   E L+ +F  YG++    VM + E G+S+GFGFV F     
Sbjct: 177 EKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVM-SKEDGKSKGFGFVAFETTEA 235

Query: 248 VNLVLQ--NGPHQLDGRTI 298
               +Q  NG    +G+++
Sbjct: 236 AEAAVQALNGKDMGEGKSL 254



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 5/153 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +     G +F+  L      + +   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 81  DPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFET 139

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
               N  +   NG   L+G+ +      PR  ++ K  G   K+F      N TE     
Sbjct: 140 EEAANTSIDKVNG-MLLNGKKVYVGKFIPRK-EREKELGEKAKLFTNVYVKNFTEDFDDE 197

Query: 413 IFRTLWEGHG--GGHYV*SXEE-KVXGFXILVF 502
             +  +E +G    + V S E+ K  GF  + F
Sbjct: 198 KLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAF 230



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  L      + L+  FS YG +    VM + E GRS+GFGFV F   S     +   
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNAASEATCAVT-- 345

Query: 272 PHQLDGRTIDPKP 310
             +L+GR +  KP
Sbjct: 346 --ELNGRVVGSKP 356


>AE013599-2625|AAM68177.1|  634|Drosophila melanogaster CG5119-PE,
           isoform E protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +2

Query: 80  EKGKLF----VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           EK KLF    V   + +   E L+ +F  YG++    VM + E G+S+GFGFV F     
Sbjct: 177 EKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVM-SKEDGKSKGFGFVAFETTEA 235

Query: 248 VNLVLQ--NGPHQLDGRTI 298
               +Q  NG    +G+++
Sbjct: 236 AEAAVQALNGKDMGEGKSL 254



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 5/153 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +     G +F+  L      + +   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 81  DPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFET 139

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
               N  +   NG   L+G+ +      PR  ++ K  G   K+F      N TE     
Sbjct: 140 EEAANTSIDKVNG-MLLNGKKVYVGKFIPRK-EREKELGEKAKLFTNVYVKNFTEDFDDE 197

Query: 413 IFRTLWEGHG--GGHYV*SXEE-KVXGFXILVF 502
             +  +E +G    + V S E+ K  GF  + F
Sbjct: 198 KLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAF 230



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  L      + L+  FS YG +    VM + E GRS+GFGFV F   S     +   
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNAASEATCAVT-- 345

Query: 272 PHQLDGRTIDPKP 310
             +L+GR +  KP
Sbjct: 346 --ELNGRVVGSKP 356


>AE013599-2624|AAM68176.1|  634|Drosophila melanogaster CG5119-PD,
           isoform D protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +2

Query: 80  EKGKLF----VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           EK KLF    V   + +   E L+ +F  YG++    VM + E G+S+GFGFV F     
Sbjct: 177 EKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVM-SKEDGKSKGFGFVAFETTEA 235

Query: 248 VNLVLQ--NGPHQLDGRTI 298
               +Q  NG    +G+++
Sbjct: 236 AEAAVQALNGKDMGEGKSL 254



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 5/153 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +     G +F+  L      + +   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 81  DPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFET 139

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
               N  +   NG   L+G+ +      PR  ++ K  G   K+F      N TE     
Sbjct: 140 EEAANTSIDKVNG-MLLNGKKVYVGKFIPRK-EREKELGEKAKLFTNVYVKNFTEDFDDE 197

Query: 413 IFRTLWEGHG--GGHYV*SXEE-KVXGFXILVF 502
             +  +E +G    + V S E+ K  GF  + F
Sbjct: 198 KLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAF 230



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  L      + L+  FS YG +    VM + E GRS+GFGFV F   S     +   
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNAASEATCAVT-- 345

Query: 272 PHQLDGRTIDPKP 310
             +L+GR +  KP
Sbjct: 346 --ELNGRVVGSKP 356


>AE013599-2623|AAF57746.1|  634|Drosophila melanogaster CG5119-PC,
           isoform C protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +2

Query: 80  EKGKLF----VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           EK KLF    V   + +   E L+ +F  YG++    VM + E G+S+GFGFV F     
Sbjct: 177 EKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVM-SKEDGKSKGFGFVAFETTEA 235

Query: 248 VNLVLQ--NGPHQLDGRTI 298
               +Q  NG    +G+++
Sbjct: 236 AEAAVQALNGKDMGEGKSL 254



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 5/153 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +     G +F+  L      + +   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 81  DPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFET 139

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
               N  +   NG   L+G+ +      PR  ++ K  G   K+F      N TE     
Sbjct: 140 EEAANTSIDKVNG-MLLNGKKVYVGKFIPRK-EREKELGEKAKLFTNVYVKNFTEDFDDE 197

Query: 413 IFRTLWEGHG--GGHYV*SXEE-KVXGFXILVF 502
             +  +E +G    + V S E+ K  GF  + F
Sbjct: 198 KLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAF 230



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  L      + L+  FS YG +    VM + E GRS+GFGFV F   S     +   
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNAASEATCAVT-- 345

Query: 272 PHQLDGRTIDPKP 310
             +L+GR +  KP
Sbjct: 346 --ELNGRVVGSKP 356


>AE013599-2622|AAF57745.1|  634|Drosophila melanogaster CG5119-PB,
           isoform B protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +2

Query: 80  EKGKLF----VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           EK KLF    V   + +   E L+ +F  YG++    VM + E G+S+GFGFV F     
Sbjct: 177 EKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVM-SKEDGKSKGFGFVAFETTEA 235

Query: 248 VNLVLQ--NGPHQLDGRTI 298
               +Q  NG    +G+++
Sbjct: 236 AEAAVQALNGKDMGEGKSL 254



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 5/153 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +     G +F+  L      + +   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 81  DPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFET 139

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
               N  +   NG   L+G+ +      PR  ++ K  G   K+F      N TE     
Sbjct: 140 EEAANTSIDKVNG-MLLNGKKVYVGKFIPRK-EREKELGEKAKLFTNVYVKNFTEDFDDE 197

Query: 413 IFRTLWEGHG--GGHYV*SXEE-KVXGFXILVF 502
             +  +E +G    + V S E+ K  GF  + F
Sbjct: 198 KLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAF 230



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  L      + L+  FS YG +    VM + E GRS+GFGFV F   S     +   
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNAASEATCAVT-- 345

Query: 272 PHQLDGRTIDPKP 310
             +L+GR +  KP
Sbjct: 346 --ELNGRVVGSKP 356


>AE013599-2621|AAM68175.1|  634|Drosophila melanogaster CG5119-PA,
           isoform A protein.
          Length = 634

 Score = 42.7 bits (96), Expect = 4e-04
 Identities = 26/79 (32%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
 Frame = +2

Query: 80  EKGKLF----VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL 247
           EK KLF    V   + +   E L+ +F  YG++    VM + E G+S+GFGFV F     
Sbjct: 177 EKAKLFTNVYVKNFTEDFDDEKLKEFFEPYGKITSYKVM-SKEDGKSKGFGFVAFETTEA 235

Query: 248 VNLVLQ--NGPHQLDGRTI 298
               +Q  NG    +G+++
Sbjct: 236 AEAAVQALNGKDMGEGKSL 254



 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 5/153 (3%)
 Frame = +2

Query: 59  NPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +P +     G +F+  L      + +   FS +G ++ C V  + E G S+G+GFV F  
Sbjct: 81  DPSLRRSGVGNVFIKNLDRAIDNKAIYDTFSAFGNILSCKVATD-EKGNSKGYGFVHFET 139

Query: 239 PSLVNLVLQ--NGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRX 412
               N  +   NG   L+G+ +      PR  ++ K  G   K+F      N TE     
Sbjct: 140 EEAANTSIDKVNG-MLLNGKKVYVGKFIPRK-EREKELGEKAKLFTNVYVKNFTEDFDDE 197

Query: 413 IFRTLWEGHG--GGHYV*SXEE-KVXGFXILVF 502
             +  +E +G    + V S E+ K  GF  + F
Sbjct: 198 KLKEFFEPYGKITSYKVMSKEDGKSKGFGFVAF 230



 Score = 41.1 bits (92), Expect = 0.001
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           L+V  L      + L+  FS YG +    VM + E GRS+GFGFV F   S     +   
Sbjct: 289 LYVKNLDDTIDDDRLRIAFSPYGNITSAKVMTDEE-GRSKGFGFVCFNAASEATCAVT-- 345

Query: 272 PHQLDGRTIDPKP 310
             +L+GR +  KP
Sbjct: 346 --ELNGRVVGSKP 356


>AY113652-1|AAM29657.1|  918|Drosophila melanogaster SD14970p
           protein.
          Length = 918

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 17/62 (27%), Positives = 39/62 (62%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           ++ + D  E G++F   L++ T++E+L++ F ++G V++  +  +  + + +GFG VT+ 
Sbjct: 354 LSKEDDISESGRIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYM 413

Query: 236 DP 241
            P
Sbjct: 414 MP 415


>AE014296-1695|AAF50237.1|  918|Drosophila melanogaster CG3335-PA
           protein.
          Length = 918

 Score = 42.3 bits (95), Expect = 5e-04
 Identities = 17/62 (27%), Positives = 39/62 (62%)
 Frame = +2

Query: 56  MNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA 235
           ++ + D  E G++F   L++ T++E+L++ F ++G V++  +  +  + + +GFG VT+ 
Sbjct: 354 LSKEDDISESGRIFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYM 413

Query: 236 DP 241
            P
Sbjct: 414 MP 415


>U59476-1|AAB07067.1|  352|Drosophila melanogaster RNA-binding
           protein lark protein.
          Length = 352

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 2/113 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+G L  +T    L+  F +YG V++C V+KN        +GFV           +QN
Sbjct: 8   KLFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDAIQN 59

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP--KVFLGGLPSNVTETDLRXIFR 421
               L+G T++          K +R    P  K+F+G L       ++R +F+
Sbjct: 60  ----LNGYTLNEFAIKVEA-AKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQ 107



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG L+ +T    ++  F +YG V++C +++N        +GFV       V  V Q+
Sbjct: 87  KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN--------YGFVHL---DCVGDV-QD 134

Query: 269 GPHQLDGRTIDPKPCNPR---TLQKPKRGGGYPK 361
              +L+GR +D +P   +   +  +PK G G P+
Sbjct: 135 AIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPE 168


>AY061458-1|AAL29006.1|  352|Drosophila melanogaster LD40792p
           protein.
          Length = 352

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 2/113 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+G L  +T    L+  F +YG V++C V+KN        +GFV           +QN
Sbjct: 8   KLFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDAIQN 59

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP--KVFLGGLPSNVTETDLRXIFR 421
               L+G T++          K +R    P  K+F+G L       ++R +F+
Sbjct: 60  ----LNGYTLNEFAIKVEA-AKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQ 107



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG L+ +T    ++  F +YG V++C +++N        +GFV       V  V Q+
Sbjct: 87  KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN--------YGFVHL---DCVGDV-QD 134

Query: 269 GPHQLDGRTIDPKPCNPR---TLQKPKRGGGYPK 361
              +L+GR +D +P   +   +  +PK G G P+
Sbjct: 135 AIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPE 168


>AE014296-1235|AAN12056.1|  352|Drosophila melanogaster CG8597-PE,
           isoform E protein.
          Length = 352

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 2/113 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+G L  +T    L+  F +YG V++C V+KN        +GFV           +QN
Sbjct: 8   KLFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDAIQN 59

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP--KVFLGGLPSNVTETDLRXIFR 421
               L+G T++          K +R    P  K+F+G L       ++R +F+
Sbjct: 60  ----LNGYTLNEFAIKVEA-AKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQ 107



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG L+ +T    ++  F +YG V++C +++N        +GFV       V  V Q+
Sbjct: 87  KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN--------YGFVHL---DCVGDV-QD 134

Query: 269 GPHQLDGRTIDPKPCNPR---TLQKPKRGGGYPK 361
              +L+GR +D +P   +   +  +PK G G P+
Sbjct: 135 AIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPE 168


>AE014296-1234|AAN12055.1|  352|Drosophila melanogaster CG8597-PD,
           isoform D protein.
          Length = 352

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 2/113 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+G L  +T    L+  F +YG V++C V+KN        +GFV           +QN
Sbjct: 8   KLFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDAIQN 59

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP--KVFLGGLPSNVTETDLRXIFR 421
               L+G T++          K +R    P  K+F+G L       ++R +F+
Sbjct: 60  ----LNGYTLNEFAIKVEA-AKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQ 107



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG L+ +T    ++  F +YG V++C +++N        +GFV       V  V Q+
Sbjct: 87  KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN--------YGFVHL---DCVGDV-QD 134

Query: 269 GPHQLDGRTIDPKPCNPR---TLQKPKRGGGYPK 361
              +L+GR +D +P   +   +  +PK G G P+
Sbjct: 135 AIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPE 168


>AE014296-1233|AAN12054.1|  352|Drosophila melanogaster CG8597-PC,
           isoform C protein.
          Length = 352

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 2/113 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+G L  +T    L+  F +YG V++C V+KN        +GFV           +QN
Sbjct: 8   KLFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDAIQN 59

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP--KVFLGGLPSNVTETDLRXIFR 421
               L+G T++          K +R    P  K+F+G L       ++R +F+
Sbjct: 60  ----LNGYTLNEFAIKVEA-AKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQ 107



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG L+ +T    ++  F +YG V++C +++N        +GFV       V  V Q+
Sbjct: 87  KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN--------YGFVHL---DCVGDV-QD 134

Query: 269 GPHQLDGRTIDPKPCNPR---TLQKPKRGGGYPK 361
              +L+GR +D +P   +   +  +PK G G P+
Sbjct: 135 AIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPE 168


>AE014296-1232|AAN12053.1|  352|Drosophila melanogaster CG8597-PB,
           isoform B protein.
          Length = 352

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 2/113 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+G L  +T    L+  F +YG V++C V+KN        +GFV           +QN
Sbjct: 8   KLFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDAIQN 59

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP--KVFLGGLPSNVTETDLRXIFR 421
               L+G T++          K +R    P  K+F+G L       ++R +F+
Sbjct: 60  ----LNGYTLNEFAIKVEA-AKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQ 107



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG L+ +T    ++  F +YG V++C +++N        +GFV       V  V Q+
Sbjct: 87  KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN--------YGFVHL---DCVGDV-QD 134

Query: 269 GPHQLDGRTIDPKPCNPR---TLQKPKRGGGYPK 361
              +L+GR +D +P   +   +  +PK G G P+
Sbjct: 135 AIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPE 168


>AE014296-1231|AAF50578.1|  352|Drosophila melanogaster CG8597-PA,
           isoform A protein.
          Length = 352

 Score = 41.9 bits (94), Expect = 6e-04
 Identities = 32/113 (28%), Positives = 51/113 (45%), Gaps = 2/113 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLF+G L  +T    L+  F +YG V++C V+KN        +GFV           +QN
Sbjct: 8   KLFIGNLDEKTQATELRALFEKYGTVVECDVVKN--------YGFVHMETEQQGRDAIQN 59

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYP--KVFLGGLPSNVTETDLRXIFR 421
               L+G T++          K +R    P  K+F+G L       ++R +F+
Sbjct: 60  ----LNGYTLNEFAIKVEA-AKSRRAPNTPTTKIFVGNLTDKTRAPEVRELFQ 107



 Score = 38.3 bits (85), Expect = 0.008
 Identities = 28/94 (29%), Positives = 49/94 (52%), Gaps = 3/94 (3%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+FVG L+ +T    ++  F +YG V++C +++N        +GFV       V  V Q+
Sbjct: 87  KIFVGNLTDKTRAPEVRELFQKYGTVVECDIVRN--------YGFVHL---DCVGDV-QD 134

Query: 269 GPHQLDGRTIDPKPCNPR---TLQKPKRGGGYPK 361
              +L+GR +D +P   +   +  +PK G G P+
Sbjct: 135 AIKELNGRVVDGQPLKVQVSTSRVRPKPGMGDPE 168


>AF239667-1|AAF43091.1|  356|Drosophila melanogaster putative RNA
           binding protein protein.
          Length = 356

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 22/78 (28%), Positives = 42/78 (53%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  +  +   L+V GL    SQ +L+  F+ +G++I   ++ ++ SG S+G GF+ F   
Sbjct: 122 PSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQR 181

Query: 242 SLVNLVLQNGPHQLDGRT 295
           +     +Q    +L+G+T
Sbjct: 182 NEAERAIQ----ELNGKT 195



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  L+ ET +  L + F  +G V    V+++ ++ + +GFGFVT    D ++V +   
Sbjct: 275 IFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSL 334

Query: 266 NG 271
           NG
Sbjct: 335 NG 336



 Score = 31.9 bits (69), Expect = 0.66
 Identities = 29/130 (22%), Positives = 55/130 (42%), Gaps = 14/130 (10%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL- 247
           +D+ +  L V  L    +QE ++  FS  GE+  C ++++  SG       +T  +P+L 
Sbjct: 21  NDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQ 80

Query: 248 ---------VNLV----LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSN 388
                    VN V     +   + L+G  +  K       +          +++ GLP N
Sbjct: 81  QGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKN 140

Query: 389 VTETDLRXIF 418
           +++ DL  +F
Sbjct: 141 LSQPDLEGMF 150



 Score = 28.7 bits (61), Expect = 6.2
 Identities = 13/46 (28%), Positives = 23/46 (50%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  + L +P     F  +GK++   I+ D     S G GF+ F+
Sbjct: 134 VSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFD 179


>AE014298-1827|AAF48215.3|  356|Drosophila melanogaster CG4396-PA
           protein.
          Length = 356

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 22/78 (28%), Positives = 42/78 (53%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADP 241
           P  +  +   L+V GL    SQ +L+  F+ +G++I   ++ ++ SG S+G GF+ F   
Sbjct: 122 PSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQR 181

Query: 242 SLVNLVLQNGPHQLDGRT 295
           +     +Q    +L+G+T
Sbjct: 182 NEAERAIQ----ELNGKT 195



 Score = 36.3 bits (80), Expect = 0.031
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFA--DPSLVNLVLQ 265
           +FV  L+ ET +  L + F  +G V    V+++ ++ + +GFGFVT    D ++V +   
Sbjct: 275 IFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTSKCKGFGFVTMTNYDEAVVAIQSL 334

Query: 266 NG 271
           NG
Sbjct: 335 NG 336



 Score = 31.9 bits (69), Expect = 0.66
 Identities = 29/130 (22%), Positives = 55/130 (42%), Gaps = 14/130 (10%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSL- 247
           +D+ +  L V  L    +QE ++  FS  GE+  C ++++  SG       +T  +P+L 
Sbjct: 21  NDESRTNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQ 80

Query: 248 ---------VNLV----LQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSN 388
                    VN V     +   + L+G  +  K       +          +++ GLP N
Sbjct: 81  QGQSLGYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKN 140

Query: 389 VTETDLRXIF 418
           +++ DL  +F
Sbjct: 141 LSQPDLEGMF 150



 Score = 28.7 bits (61), Expect = 6.2
 Identities = 13/46 (28%), Positives = 23/46 (50%)
 Frame = +3

Query: 369 LAGCHRTLPKPISGXFFGRYGKVMEVVIMYDQXKKKSXGXGFLSFE 506
           ++G  + L +P     F  +GK++   I+ D     S G GF+ F+
Sbjct: 134 VSGLPKNLSQPDLEGMFASFGKIITSRILCDNISGLSKGVGFIRFD 179


>BT001582-1|AAN71337.1|  977|Drosophila melanogaster RE24907p
           protein.
          Length = 977

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           L+V GLS  T   +L+  FS++G+VI   V+ N+ +  +R +G+VT +  +  +  ++N 
Sbjct: 363 LWVSGLSTLTRASDLKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASRCIENL 422

Query: 269 GPHQLDGRTI 298
              +L GR I
Sbjct: 423 HRTELHGRII 432


>AY061541-1|AAL29089.1|  392|Drosophila melanogaster LP03039p
           protein.
          Length = 392

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           L+V GLS  T   +L+  FS++G+VI   V+ N+ +  +R +G+VT +  +  +  ++N 
Sbjct: 52  LWVSGLSTLTRASDLKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASRCIENL 111

Query: 269 GPHQLDGRTI 298
              +L GR I
Sbjct: 112 HRTELHGRII 121


>AE014297-3637|ABC66187.1|  392|Drosophila melanogaster CG6995-PC,
           isoform C protein.
          Length = 392

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           L+V GLS  T   +L+  FS++G+VI   V+ N+ +  +R +G+VT +  +  +  ++N 
Sbjct: 52  LWVSGLSTLTRASDLKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASRCIENL 111

Query: 269 GPHQLDGRTI 298
              +L GR I
Sbjct: 112 HRTELHGRII 121


>AE014297-3636|AAF56343.3|  666|Drosophila melanogaster CG6995-PA,
           isoform A protein.
          Length = 666

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           L+V GLS  T   +L+  FS++G+VI   V+ N+ +  +R +G+VT +  +  +  ++N 
Sbjct: 52  LWVSGLSTLTRASDLKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASRCIENL 111

Query: 269 GPHQLDGRTI 298
              +L GR I
Sbjct: 112 HRTELHGRII 121


>AE014297-3635|AAN14018.2|  928|Drosophila melanogaster CG6995-PB,
           isoform B protein.
          Length = 928

 Score = 40.7 bits (91), Expect = 0.001
 Identities = 23/70 (32%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN- 268
           L+V GLS  T   +L+  FS++G+VI   V+ N+ +  +R +G+VT +  +  +  ++N 
Sbjct: 314 LWVSGLSTLTRASDLKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTMSSSADASRCIENL 373

Query: 269 GPHQLDGRTI 298
              +L GR I
Sbjct: 374 HRTELHGRII 383


>AY118564-1|AAM49933.1|  578|Drosophila melanogaster LD40028p
           protein.
          Length = 578

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 25/108 (23%), Positives = 50/108 (46%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           K  L++ GL   T+ ++L    ++YG +I    + +  + + +G+GFV F  P+     +
Sbjct: 230 KTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAV 289

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
           +     L G+ +  +    +  Q P        +++  LP +  ETDL
Sbjct: 290 KG----LQGKGVQAQMAKQQE-QDP------TNLYIANLPPHFKETDL 326



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 12/64 (18%), Positives = 30/64 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           + +   L++  L     + +L+   S+YG+V+   ++++ +   S+G GF          
Sbjct: 306 EQDPTNLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM-NSKGVGFARMESREKCE 364

Query: 254 LVLQ 265
            ++Q
Sbjct: 365 QIIQ 368


>AE014296-940|AAF50792.3|  368|Drosophila melanogaster CG32423-PC,
           isoform C protein.
          Length = 368

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 25/108 (23%), Positives = 50/108 (46%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           K  L++ GL   T+ ++L    ++YG +I    + +  + + +G+GFV F  P+     +
Sbjct: 20  KTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAV 79

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
           +     L G+ +  +    +  Q P        +++  LP +  ETDL
Sbjct: 80  KG----LQGKGVQAQMAKQQE-QDP------TNLYIANLPPHFKETDL 116



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 12/64 (18%), Positives = 30/64 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           + +   L++  L     + +L+   S+YG+V+   ++++ +   S+G GF          
Sbjct: 96  EQDPTNLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM-NSKGVGFARMESREKCE 154

Query: 254 LVLQ 265
            ++Q
Sbjct: 155 QIIQ 158


>AE014296-937|AAF50788.5|  578|Drosophila melanogaster CG32423-PA,
           isoform A protein.
          Length = 578

 Score = 39.9 bits (89), Expect = 0.002
 Identities = 25/108 (23%), Positives = 50/108 (46%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           K  L++ GL   T+ ++L    ++YG +I    + +  + + +G+GFV F  P+     +
Sbjct: 230 KTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAV 289

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDL 406
           +     L G+ +  +    +  Q P        +++  LP +  ETDL
Sbjct: 290 KG----LQGKGVQAQMAKQQE-QDP------TNLYIANLPPHFKETDL 326



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 12/64 (18%), Positives = 30/64 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           + +   L++  L     + +L+   S+YG+V+   ++++ +   S+G GF          
Sbjct: 306 EQDPTNLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM-NSKGVGFARMESREKCE 364

Query: 254 LVLQ 265
            ++Q
Sbjct: 365 QIIQ 368


>AY094948-1|AAM11301.1|  379|Drosophila melanogaster RH63980p
           protein.
          Length = 379

 Score = 39.5 bits (88), Expect = 0.003
 Identities = 25/112 (22%), Positives = 52/112 (46%), Gaps = 4/112 (3%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           K  L++ GL   T+ ++L    ++YG +I    + +  + + +G+GFV F  P+     +
Sbjct: 20  KTNLYIRGLQQGTTDKDLVNMCAQYGTIISTKAILDKTTNKCKGYGFVDFEQPAFAECAV 79

Query: 263 QNGPHQLDGRTIDPKPCNPR--TLQKP--KRGGGYPKVFLGGLPSNVTETDL 406
           +     L G+ +  +        L +P  ++      +++  LP +  ETDL
Sbjct: 80  KG----LQGKGVQAQMAKVGIWVLHRPAIQQEQDPTNLYIANLPPHFKETDL 127



 Score = 28.3 bits (60), Expect = 8.2
 Identities = 12/64 (18%), Positives = 30/64 (46%)
 Frame = +2

Query: 74  DDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           + +   L++  L     + +L+   S+YG+V+   ++++ +   S+G GF          
Sbjct: 107 EQDPTNLYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQM-NSKGVGFARMESREKCE 165

Query: 254 LVLQ 265
            ++Q
Sbjct: 166 QIIQ 169


>X97197-1|CAA65831.1|  366|Drosophila melanogaster spliceosomal
           protein protein.
          Length = 366

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCV-VMKNSESGRSRGFGFVTFA 235
           D    +F+G L  E  ++ L   FS +G ++    +M++ E+G+S+ F F+ FA
Sbjct: 116 DVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFA 169


>BT023489-1|AAY84889.1|  347|Drosophila melanogaster RE50839p
           protein.
          Length = 347

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCV-VMKNSESGRSRGFGFVTFA 235
           D    +F+G L  E  ++ L   FS +G ++    +M++ E+G+S+ F F+ FA
Sbjct: 97  DVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFA 150



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 16/61 (26%), Positives = 31/61 (50%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           M   P  + ++   ++ GGL  + S+  L   F + G V++  + K+  +   +G+GFV 
Sbjct: 1   MAAGPIAERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVE 60

Query: 230 F 232
           F
Sbjct: 61  F 61


>BT003653-1|AAO39657.1|  626|Drosophila melanogaster AT01548p
           protein.
          Length = 626

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 28/116 (24%), Positives = 50/116 (43%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++F G +  +  ++ L   F   G + D  +M +  +G +RG+ FVTF +         N
Sbjct: 126 EVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNRE----AAVN 181

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEG 436
              QLD   I P  C    +  P       ++F+G +P +  + ++   F  L  G
Sbjct: 182 AVRQLDNHEIKPGKCLKINISVPNL-----RLFVGNIPKSKGKDEILEEFGKLTAG 232


>AY060398-1|AAL25437.1|  422|Drosophila melanogaster LD31834p
           protein.
          Length = 422

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 17/60 (28%), Positives = 34/60 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG LS + +++++++ F  +G + +C +++  + G S+G  FV F         + N
Sbjct: 56  KLFVGMLSKQQTEDDVRQIFHPFGTIEECTILRGPD-GASKGCAFVKFGSQQEAQSAITN 114


>AE014298-857|AAF46136.1|  347|Drosophila melanogaster CG3780-PA
           protein.
          Length = 347

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 1/54 (1%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCV-VMKNSESGRSRGFGFVTFA 235
           D    +F+G L  E  ++ L   FS +G ++    +M++ E+G+S+ F F+ FA
Sbjct: 97  DVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFA 150



 Score = 32.3 bits (70), Expect = 0.50
 Identities = 16/61 (26%), Positives = 31/61 (50%)
 Frame = +2

Query: 50  MRMNPDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVT 229
           M   P  + ++   ++ GGL  + S+  L   F + G V++  + K+  +   +G+GFV 
Sbjct: 1   MAAGPIAERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVE 60

Query: 230 F 232
           F
Sbjct: 61  F 61


>AE014297-2864|AAN13834.1|  529|Drosophila melanogaster CG17838-PF,
           isoform F protein.
          Length = 529

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 28/116 (24%), Positives = 50/116 (43%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++F G +  +  ++ L   F   G + D  +M +  +G +RG+ FVTF +         N
Sbjct: 165 EVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNRE----AAVN 220

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEG 436
              QLD   I P  C    +  P       ++F+G +P +  + ++   F  L  G
Sbjct: 221 AVRQLDNHEIKPGKCLKINISVPNL-----RLFVGNIPKSKGKDEILEEFGKLTAG 271


>AE014297-2863|AAN13833.1|  529|Drosophila melanogaster CG17838-PC,
           isoform C protein.
          Length = 529

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 28/116 (24%), Positives = 50/116 (43%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++F G +  +  ++ L   F   G + D  +M +  +G +RG+ FVTF +         N
Sbjct: 165 EVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNRE----AAVN 220

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEG 436
              QLD   I P  C    +  P       ++F+G +P +  + ++   F  L  G
Sbjct: 221 AVRQLDNHEIKPGKCLKINISVPNL-----RLFVGNIPKSKGKDEILEEFGKLTAG 271


>AE014297-2862|AAF55805.2|  707|Drosophila melanogaster CG17838-PD,
           isoform D protein.
          Length = 707

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 28/116 (24%), Positives = 50/116 (43%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++F G +  +  ++ L   F   G + D  +M +  +G +RG+ FVTF +         N
Sbjct: 207 EVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNRE----AAVN 262

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEG 436
              QLD   I P  C    +  P       ++F+G +P +  + ++   F  L  G
Sbjct: 263 AVRQLDNHEIKPGKCLKINISVPNL-----RLFVGNIPKSKGKDEILEEFGKLTAG 313


>AE014297-2861|AAN13831.1|  571|Drosophila melanogaster CG17838-PE,
           isoform E protein.
          Length = 571

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 28/116 (24%), Positives = 50/116 (43%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++F G +  +  ++ L   F   G + D  +M +  +G +RG+ FVTF +         N
Sbjct: 207 EVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNRE----AAVN 262

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEG 436
              QLD   I P  C    +  P       ++F+G +P +  + ++   F  L  G
Sbjct: 263 AVRQLDNHEIKPGKCLKINISVPNL-----RLFVGNIPKSKGKDEILEEFGKLTAG 313


>AE014297-2858|AAN13832.2|  563|Drosophila melanogaster CG17838-PA,
           isoform A protein.
          Length = 563

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 28/116 (24%), Positives = 50/116 (43%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++F G +  +  ++ L   F   G + D  +M +  +G +RG+ FVTF +         N
Sbjct: 199 EVFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNRE----AAVN 254

Query: 269 GPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRTLWEG 436
              QLD   I P  C    +  P       ++F+G +P +  + ++   F  L  G
Sbjct: 255 AVRQLDNHEIKPGKCLKINISVPNL-----RLFVGNIPKSKGKDEILEEFGKLTAG 305


>AE014296-2305|AAF49798.2|  422|Drosophila melanogaster CG12478-PA,
           isoform A protein.
          Length = 422

 Score = 38.7 bits (86), Expect = 0.006
 Identities = 17/60 (28%), Positives = 34/60 (56%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           KLFVG LS + +++++++ F  +G + +C +++  + G S+G  FV F         + N
Sbjct: 56  KLFVGMLSKQQTEDDVRQIFHPFGTIEECTILRGPD-GASKGCAFVKFGSQQEAQSAITN 114


>AY075220-1|AAL68087.1|  449|Drosophila melanogaster AT16577p
           protein.
          Length = 449

 Score = 38.3 bits (85), Expect = 0.008
 Identities = 15/59 (25%), Positives = 33/59 (55%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   K++VGGL    +Q+ ++     +GE+    ++ ++ +  ++GF F  + DPS+ +
Sbjct: 239 DSPNKIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTD 297


>AE013599-3557|AAF46969.1|  449|Drosophila melanogaster CG3162-PA
           protein.
          Length = 449

 Score = 38.3 bits (85), Expect = 0.008
 Identities = 15/59 (25%), Positives = 33/59 (55%)
 Frame = +2

Query: 77  DEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVN 253
           D   K++VGGL    +Q+ ++     +GE+    ++ ++ +  ++GF F  + DPS+ +
Sbjct: 239 DSPNKIYVGGLPTCLNQDQVKELLQSFGELKGLNLVMDTNTNLNKGFAFFEYCDPSVTD 297


>AY089405-1|AAL90143.1|  251|Drosophila melanogaster AT22957p
           protein.
          Length = 251

 Score = 37.9 bits (84), Expect = 0.010
 Identities = 26/114 (22%), Positives = 51/114 (44%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           K  L +  L  + ++  L R FS++GE+    ++++  +G S  +GFV +         +
Sbjct: 40  KTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAV 99

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
            NG   +DG     K       +  +       +++G LP+ + E  +R +F T
Sbjct: 100 -NG---MDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFAT 149



 Score = 37.9 bits (84), Expect = 0.010
 Identities = 15/57 (26%), Positives = 30/57 (52%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P   +     L+VG L     ++ ++  F+ YG ++D  ++++  + RSRG  F+ F
Sbjct: 119 PSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQF 175


>AE014297-2054|AAF55205.1|  251|Drosophila melanogaster CG5213-PA
           protein.
          Length = 251

 Score = 37.9 bits (84), Expect = 0.010
 Identities = 26/114 (22%), Positives = 51/114 (44%)
 Frame = +2

Query: 83  KGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVL 262
           K  L +  L  + ++  L R FS++GE+    ++++  +G S  +GFV +         +
Sbjct: 40  KTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAAV 99

Query: 263 QNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYPKVFLGGLPSNVTETDLRXIFRT 424
            NG   +DG     K       +  +       +++G LP+ + E  +R +F T
Sbjct: 100 -NG---MDGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFAT 149



 Score = 37.9 bits (84), Expect = 0.010
 Identities = 15/57 (26%), Positives = 30/57 (52%)
 Frame = +2

Query: 62  PDMDDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           P   +     L+VG L     ++ ++  F+ YG ++D  ++++  + RSRG  F+ F
Sbjct: 119 PSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQF 175


>BT021281-1|AAX33429.1|  238|Drosophila melanogaster RE36241p
           protein.
          Length = 238

 Score = 37.5 bits (83), Expect = 0.013
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +D+E+  LF G L    ++E L   F + G  I+ V +    +GR R FGFVT+
Sbjct: 65  EDEEQRTLFCGNLDERVTEEILYEVFLQAGP-IEGVRIPTDNNGRPRNFGFVTY 117


>AY061534-1|AAL29082.1|  232|Drosophila melanogaster LP01585p
           protein.
          Length = 232

 Score = 37.5 bits (83), Expect = 0.013
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +D+E+  LF G L    ++E L   F + G  I+ V +    +GR R FGFVT+
Sbjct: 59  EDEEQRTLFCGNLDERVTEEILYEVFLQAGP-IEGVRIPTDNNGRPRNFGFVTY 111


>AE014134-47|AAF51542.1|  238|Drosophila melanogaster CG11454-PA
           protein.
          Length = 238

 Score = 37.5 bits (83), Expect = 0.013
 Identities = 20/54 (37%), Positives = 30/54 (55%)
 Frame = +2

Query: 71  DDDEKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           +D+E+  LF G L    ++E L   F + G  I+ V +    +GR R FGFVT+
Sbjct: 65  EDEEQRTLFCGNLDERVTEEILYEVFLQAGP-IEGVRIPTDNNGRPRNFGFVTY 117


>AY071293-1|AAL48915.1|  170|Drosophila melanogaster RE32504p
           protein.
          Length = 170

 Score = 37.1 bits (82), Expect = 0.018
 Identities = 16/59 (27%), Positives = 33/59 (55%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           E+G + V  L     ++ L++YF ++G V+   + ++  +G S+G+ FV F  P +  +
Sbjct: 49  ERGVVIVKHLPHGFFEQQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEFEYPEVAKV 107


>AE014297-3189|AAF56024.1|  356|Drosophila melanogaster CG6937-PA
           protein.
          Length = 356

 Score = 37.1 bits (82), Expect = 0.018
 Identities = 16/59 (27%), Positives = 33/59 (55%)
 Frame = +2

Query: 80  EKGKLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNL 256
           E+G + V  L     ++ L++YF ++G V+   + ++  +G S+G+ FV F  P +  +
Sbjct: 49  ERGVVIVKHLPHGFFEQQLRQYFRQFGRVLRVRLARSLRTGNSKGYAFVEFEYPEVAKV 107


>AE014297-952|AAF54387.1|  632|Drosophila melanogaster CG9373-PA
           protein.
          Length = 632

 Score = 37.1 bits (82), Expect = 0.018
 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           ++++  + ++   ++L+  F R    I+ V +   ESG++RG G V F DP  V   L+ 
Sbjct: 58  RVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEK 117

Query: 269 -GPHQLDGRTI 298
              ++++GR +
Sbjct: 118 MNRYEVNGREL 128


>S51738-1|AAB24630.1|   44|Drosophila melanogaster RNA recognition
           motif-type RNA-binding protein protein.
          Length = 44

 Score = 36.7 bits (81), Expect = 0.023
 Identities = 16/44 (36%), Positives = 27/44 (61%)
 Frame = +2

Query: 95  FVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFV 226
           FV  L    SQ+ ++  F  +GEV  C ++++  +G+S G+GFV
Sbjct: 1   FVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTGQSLGYGFV 44


>BT003317-1|AAO25077.1|  545|Drosophila melanogaster GH01086p
           protein.
          Length = 545

 Score = 36.7 bits (81), Expect = 0.023
 Identities = 25/118 (21%), Positives = 60/118 (50%), Gaps = 8/118 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +++VG +S+E  ++ ++  F+ +G +    +  +  + + +GF FV +  P    L L+ 
Sbjct: 39  RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQ 98

Query: 266 -NGPHQLDGRTID-PKPCN-PRTLQ----KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            NG   + GR I   +P N P+  Q      +    + ++++  +  +++E D++ +F
Sbjct: 99  MNGA-LMGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVF 155


>AY061006-1|AAL28554.1|  545|Drosophila melanogaster HL02140p
           protein.
          Length = 545

 Score = 36.7 bits (81), Expect = 0.023
 Identities = 25/118 (21%), Positives = 60/118 (50%), Gaps = 8/118 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +++VG +S+E  ++ ++  F+ +G +    +  +  + + +GF FV +  P    L L+ 
Sbjct: 39  RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQ 98

Query: 266 -NGPHQLDGRTID-PKPCN-PRTLQ----KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            NG   + GR I   +P N P+  Q      +    + ++++  +  +++E D++ +F
Sbjct: 99  MNGA-LMGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVF 155


>AF479079-1|AAL86452.1|  637|Drosophila melanogaster half pint
           protein.
          Length = 637

 Score = 36.7 bits (81), Expect = 0.023
 Identities = 25/118 (21%), Positives = 60/118 (50%), Gaps = 8/118 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +++VG +S+E  ++ ++  F+ +G +    +  +  + + +GF FV +  P    L L+ 
Sbjct: 131 RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQ 190

Query: 266 -NGPHQLDGRTID-PKPCN-PRTLQ----KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            NG   + GR I   +P N P+  Q      +    + ++++  +  +++E D++ +F
Sbjct: 191 MNGA-LMGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVF 247


>AF190745-1|AAF04132.1|  637|Drosophila melanogaster poly-U binding
           splicing factor protein.
          Length = 637

 Score = 36.7 bits (81), Expect = 0.023
 Identities = 25/118 (21%), Positives = 60/118 (50%), Gaps = 8/118 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +++VG +S+E  ++ ++  F+ +G +    +  +  + + +GF FV +  P    L L+ 
Sbjct: 131 RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQ 190

Query: 266 -NGPHQLDGRTID-PKPCN-PRTLQ----KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            NG   + GR I   +P N P+  Q      +    + ++++  +  +++E D++ +F
Sbjct: 191 MNGA-LMGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVF 247


>AE014296-262|AAG22222.2|  545|Drosophila melanogaster CG12085-PD,
           isoform D protein.
          Length = 545

 Score = 36.7 bits (81), Expect = 0.023
 Identities = 25/118 (21%), Positives = 60/118 (50%), Gaps = 8/118 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +++VG +S+E  ++ ++  F+ +G +    +  +  + + +GF FV +  P    L L+ 
Sbjct: 39  RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQ 98

Query: 266 -NGPHQLDGRTID-PKPCN-PRTLQ----KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            NG   + GR I   +P N P+  Q      +    + ++++  +  +++E D++ +F
Sbjct: 99  MNGA-LMGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVF 155


>AE014296-261|AAF47502.1|  545|Drosophila melanogaster CG12085-PC,
           isoform C protein.
          Length = 545

 Score = 36.7 bits (81), Expect = 0.023
 Identities = 25/118 (21%), Positives = 60/118 (50%), Gaps = 8/118 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +++VG +S+E  ++ ++  F+ +G +    +  +  + + +GF FV +  P    L L+ 
Sbjct: 39  RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQ 98

Query: 266 -NGPHQLDGRTID-PKPCN-PRTLQ----KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            NG   + GR I   +P N P+  Q      +    + ++++  +  +++E D++ +F
Sbjct: 99  MNGA-LMGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVF 155


>AE014296-260|AAG22221.1|  545|Drosophila melanogaster CG12085-PB,
           isoform B protein.
          Length = 545

 Score = 36.7 bits (81), Expect = 0.023
 Identities = 25/118 (21%), Positives = 60/118 (50%), Gaps = 8/118 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +++VG +S+E  ++ ++  F+ +G +    +  +  + + +GF FV +  P    L L+ 
Sbjct: 39  RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQ 98

Query: 266 -NGPHQLDGRTID-PKPCN-PRTLQ----KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            NG   + GR I   +P N P+  Q      +    + ++++  +  +++E D++ +F
Sbjct: 99  MNGA-LMGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVF 155


>AE014296-259|AAF47501.1|  637|Drosophila melanogaster CG12085-PA,
           isoform A protein.
          Length = 637

 Score = 36.7 bits (81), Expect = 0.023
 Identities = 25/118 (21%), Positives = 60/118 (50%), Gaps = 8/118 (6%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQ- 265
           +++VG +S+E  ++ ++  F+ +G +    +  +  + + +GF FV +  P    L L+ 
Sbjct: 131 RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQ 190

Query: 266 -NGPHQLDGRTID-PKPCN-PRTLQ----KPKRGGGYPKVFLGGLPSNVTETDLRXIF 418
            NG   + GR I   +P N P+  Q      +    + ++++  +  +++E D++ +F
Sbjct: 191 MNGA-LMGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRIYVASIHPDLSEEDIKSVF 247


>L34934-1|AAA73522.1|  224|Drosophila melanogaster RNA binding
           protein protein.
          Length = 224

 Score = 36.3 bits (80), Expect = 0.031
 Identities = 17/69 (24%), Positives = 29/69 (42%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG + +  S E L+ +F   G +    ++ N   G  +GF ++ F     V   L   
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 272 PHQLDGRTI 298
                GR I
Sbjct: 158 ETLFRGRQI 166


>BT003274-1|AAO25031.1|  313|Drosophila melanogaster LD15419p
           protein.
          Length = 313

 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/67 (26%), Positives = 34/67 (50%)
 Frame = +2

Query: 179 VMKNSESGRSRGFGFVTFADPSLVNLVLQNGPHQLDGRTIDPKPCNPRTLQKPKRGGGYP 358
           ++ + ++ R RGFGFVTF +  +V+ V +   H +  + ++ K   P+    P       
Sbjct: 1   MLMDQQTKRHRGFGFVTFENEDVVDRVCEIHFHTIKNKKVECKKAQPKEAVTPAAQLLQK 60

Query: 359 KVFLGGL 379
           ++ LG L
Sbjct: 61  RIMLGTL 67


>AY075519-1|AAL68327.1|  224|Drosophila melanogaster RE69521p
           protein.
          Length = 224

 Score = 36.3 bits (80), Expect = 0.031
 Identities = 17/69 (24%), Positives = 29/69 (42%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG + +  S E L+ +F   G +    ++ N   G  +GF ++ F     V   L   
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 272 PHQLDGRTI 298
                GR I
Sbjct: 158 ETLFRGRQI 166


>AY070631-1|AAL48102.1|  224|Drosophila melanogaster RE74211p
           protein.
          Length = 224

 Score = 36.3 bits (80), Expect = 0.031
 Identities = 17/69 (24%), Positives = 29/69 (42%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG + +  S E L+ +F   G +    ++ N   G  +GF ++ F     V   L   
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 272 PHQLDGRTI 298
                GR I
Sbjct: 158 ETLFRGRQI 166


>AY060253-1|AAL25292.1|  238|Drosophila melanogaster GH07919p
           protein.
          Length = 238

 Score = 36.3 bits (80), Expect = 0.031
 Identities = 18/59 (30%), Positives = 33/59 (55%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           +FV  L+ +T +  L + F  +G V    V+++ +S + +GFGFVT  +     L +Q+
Sbjct: 157 IFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQS 215


>AF116341-1|AAF00976.1|  224|Drosophila melanogaster poly(A)-binding
           protein II protein.
          Length = 224

 Score = 36.3 bits (80), Expect = 0.031
 Identities = 17/69 (24%), Positives = 29/69 (42%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG + +  S E L+ +F   G +    ++ N   G  +GF ++ F     V   L   
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 272 PHQLDGRTI 298
                GR I
Sbjct: 158 ETLFRGRQI 166


>AE013599-599|AAM68852.1|  224|Drosophila melanogaster CG2163-PB,
           isoform B protein.
          Length = 224

 Score = 36.3 bits (80), Expect = 0.031
 Identities = 17/69 (24%), Positives = 29/69 (42%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG + +  S E L+ +F   G +    ++ N   G  +GF ++ F     V   L   
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 272 PHQLDGRTI 298
                GR I
Sbjct: 158 ETLFRGRQI 166


>AE013599-598|AAF59127.1|  224|Drosophila melanogaster CG2163-PA,
           isoform A protein.
          Length = 224

 Score = 36.3 bits (80), Expect = 0.031
 Identities = 17/69 (24%), Positives = 29/69 (42%)
 Frame = +2

Query: 92  LFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQNG 271
           ++VG + +  S E L+ +F   G +    ++ N   G  +GF ++ F     V   L   
Sbjct: 98  VYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHPKGFAYIEFGSKEFVETALAMN 157

Query: 272 PHQLDGRTI 298
                GR I
Sbjct: 158 ETLFRGRQI 166


>X57484-1|CAA40722.1|  264|Drosophila melanogaster tra-2 protein.
          Length = 264

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 145


>M30939-4|AAA28956.1|  179|Drosophila melanogaster transformer-2
           protein C protein.
          Length = 179

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 16  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 60


>M30939-3|AAA28955.1|  226|Drosophila melanogaster transformer-2
           protein B protein.
          Length = 226

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 63  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 107


>M30939-1|AAA28954.1|  264|Drosophila melanogaster transformer-2
           protein A protein.
          Length = 264

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 145


>M23633-1|AAA28953.1|  264|Drosophila melanogaster protein (
           D.melanogaster transformer-2 (tra-2) protein mRNA,
           complete cds. ).
          Length = 264

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 145


>J03155-1|AAA62771.1|  256|Drosophila melanogaster transformer-2
           protein.
          Length = 256

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 93  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 137


>BT010058-1|AAQ22527.1|  865|Drosophila melanogaster LD15974p
           protein.
          Length = 865

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 18/50 (36%), Positives = 31/50 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +L V  + +     +L+  F ++G ++D  ++ N E G S+GFGFVTFA+
Sbjct: 378 RLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFN-ERG-SKGFGFVTFAN 425


>BT001315-1|AAN71070.1|  617|Drosophila melanogaster AT14906p
           protein.
          Length = 617

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/66 (24%), Positives = 35/66 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GG+ W+ S+++L + F  +G +      K  ++ + +G+ ++ F     V  +L  
Sbjct: 279 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 338

Query: 269 GPHQLD 286
              Q+D
Sbjct: 339 CVLQVD 344



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 356 PKVFLGGLPSNVTETDLRXIFR 421
           PKVFLGG+P +++E  L  IF+
Sbjct: 278 PKVFLGGIPWDISEQSLIQIFK 299


>BT001292-1|AAN71048.1|  582|Drosophila melanogaster AT10134p
           protein.
          Length = 582

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/66 (24%), Positives = 35/66 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GG+ W+ S+++L + F  +G +      K  ++ + +G+ ++ F     V  +L  
Sbjct: 244 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 303

Query: 269 GPHQLD 286
              Q+D
Sbjct: 304 CVLQVD 309



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 356 PKVFLGGLPSNVTETDLRXIFR 421
           PKVFLGG+P +++E  L  IF+
Sbjct: 243 PKVFLGGIPWDISEQSLIQIFK 264


>AY118678-1|AAM50538.1|  582|Drosophila melanogaster AT08247p
           protein.
          Length = 582

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 18/50 (36%), Positives = 31/50 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +L V  + +     +L+  F ++G ++D  ++ N E G S+GFGFVTFA+
Sbjct: 198 RLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFN-ERG-SKGFGFVTFAN 245


>AY058768-1|AAL13997.1|  264|Drosophila melanogaster SD04329p
           protein.
          Length = 264

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 145


>AE014297-3308|AAN13938.2|  559|Drosophila melanogaster CG10868-PE,
           isoform E protein.
          Length = 559

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/66 (24%), Positives = 35/66 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GG+ W+ S+++L + F  +G +      K  ++ + +G+ ++ F     V  +L  
Sbjct: 221 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 280

Query: 269 GPHQLD 286
              Q+D
Sbjct: 281 CVLQVD 286



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 356 PKVFLGGLPSNVTETDLRXIFR 421
           PKVFLGG+P +++E  L  IF+
Sbjct: 220 PKVFLGGIPWDISEQSLIQIFK 241


>AE014297-3307|AAN13937.1|  559|Drosophila melanogaster CG10868-PC,
           isoform C protein.
          Length = 559

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/66 (24%), Positives = 35/66 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GG+ W+ S+++L + F  +G +      K  ++ + +G+ ++ F     V  +L  
Sbjct: 221 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 280

Query: 269 GPHQLD 286
              Q+D
Sbjct: 281 CVLQVD 286



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 356 PKVFLGGLPSNVTETDLRXIFR 421
           PKVFLGG+P +++E  L  IF+
Sbjct: 220 PKVFLGGIPWDISEQSLIQIFK 241


>AE014297-3306|AAN13936.2|  913|Drosophila melanogaster CG10868-PD,
           isoform D protein.
          Length = 913

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/66 (24%), Positives = 35/66 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GG+ W+ S+++L + F  +G +      K  ++ + +G+ ++ F     V  +L  
Sbjct: 575 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 634

Query: 269 GPHQLD 286
              Q+D
Sbjct: 635 CVLQVD 640



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 356 PKVFLGGLPSNVTETDLRXIFR 421
           PKVFLGG+P +++E  L  IF+
Sbjct: 574 PKVFLGGIPWDISEQSLIQIFK 595


>AE014297-3305|AAN13935.1|  913|Drosophila melanogaster CG10868-PB,
           isoform B protein.
          Length = 913

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/66 (24%), Positives = 35/66 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GG+ W+ S+++L + F  +G +      K  ++ + +G+ ++ F     V  +L  
Sbjct: 575 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 634

Query: 269 GPHQLD 286
              Q+D
Sbjct: 635 CVLQVD 640



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 356 PKVFLGGLPSNVTETDLRXIFR 421
           PKVFLGG+P +++E  L  IF+
Sbjct: 574 PKVFLGGIPWDISEQSLIQIFK 595


>AE014297-3304|AAF56120.1|  915|Drosophila melanogaster CG10868-PA,
           isoform A protein.
          Length = 915

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/66 (24%), Positives = 35/66 (53%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFADPSLVNLVLQN 268
           K+F+GG+ W+ S+++L + F  +G +      K  ++ + +G+ ++ F     V  +L  
Sbjct: 577 KVFLGGIPWDISEQSLIQIFKPFGSIKVEWPGKEQQAAQPKGYVYIIFESDKQVKALLSA 636

Query: 269 GPHQLD 286
              Q+D
Sbjct: 637 CVLQVD 642



 Score = 30.3 bits (65), Expect = 2.0
 Identities = 12/22 (54%), Positives = 17/22 (77%)
 Frame = +2

Query: 356 PKVFLGGLPSNVTETDLRXIFR 421
           PKVFLGG+P +++E  L  IF+
Sbjct: 576 PKVFLGGIPWDISEQSLIQIFK 597


>AE014296-1825|AAF50154.2|  849|Drosophila melanogaster CG32062-PB,
           isoform B protein.
          Length = 849

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 18/50 (36%), Positives = 31/50 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +L V  + +     +L+  F ++G ++D  ++ N E G S+GFGFVTFA+
Sbjct: 436 RLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFN-ERG-SKGFGFVTFAN 483


>AE014296-1824|AAF50153.2|  881|Drosophila melanogaster CG32062-PD,
           isoform D protein.
          Length = 881

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 18/50 (36%), Positives = 31/50 (62%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +L V  + +     +L+  F ++G ++D  ++ N E G S+GFGFVTFA+
Sbjct: 436 RLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFN-ERG-SKGFGFVTFAN 483


>AE013599-1917|AAM68559.1|  179|Drosophila melanogaster CG10128-PE,
           isoform E protein.
          Length = 179

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 16  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 60


>AE013599-1916|AAM68558.1|  226|Drosophila melanogaster CG10128-PD,
           isoform D protein.
          Length = 226

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 63  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 107


>AE013599-1915|AAM68557.1|  226|Drosophila melanogaster CG10128-PC,
           isoform C protein.
          Length = 226

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 63  VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 107


>AE013599-1914|AAS64911.1|  264|Drosophila melanogaster CG10128-PG,
           isoform G protein.
          Length = 264

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 145


>AE013599-1913|AAS64910.1|  264|Drosophila melanogaster CG10128-PF,
           isoform F protein.
          Length = 264

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 145


>AE013599-1912|AAF58232.2|  264|Drosophila melanogaster CG10128-PA,
           isoform A protein.
          Length = 264

 Score = 35.9 bits (79), Expect = 0.041
 Identities = 16/45 (35%), Positives = 29/45 (64%)
 Frame = +2

Query: 98  VGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           V GL+  TSQ  ++  F++YG +    ++ ++++ RSRGF F+ F
Sbjct: 101 VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYF 145


>X62599-1|CAA44483.1|  376|Drosophila melanogaster 52-kD bracketing
           protein protein.
          Length = 376

 Score = 35.5 bits (78), Expect = 0.054
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +++VGGL +   + +L+R+F  YG   D +++KN       G+GFV F D
Sbjct: 5   RVYVGGLPYGVRERDLERFFKGYGRTRD-ILIKN-------GYGFVEFED 46


>X58720-1|CAA41556.1|  350|Drosophila melanogaster SRp55 protein.
          Length = 350

 Score = 35.5 bits (78), Expect = 0.054
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +++VGGL +   + +L+R+F  YG   D +++KN       G+GFV F D
Sbjct: 5   RVYVGGLPYGVRERDLERFFKGYGRTRD-ILIKN-------GYGFVEFED 46


>BT003286-1|AAO25044.1|  350|Drosophila melanogaster GM10155p
           protein.
          Length = 350

 Score = 35.5 bits (78), Expect = 0.054
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +++VGGL +   + +L+R+F  YG   D +++KN       G+GFV F D
Sbjct: 5   RVYVGGLPYGVRERDLERFFKGYGRTRD-ILIKN-------GYGFVEFED 46


>BT001728-1|AAN71483.1|  470|Drosophila melanogaster RE70333p
           protein.
          Length = 470

 Score = 35.5 bits (78), Expect = 0.054
 Identities = 12/37 (32%), Positives = 25/37 (67%)
 Frame = +2

Query: 122 SQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTF 232
           ++E+++  FS++G+V    ++K   +G  +GFG+V F
Sbjct: 134 TEEDIREEFSQWGDVESVTIVKEKNNGNPKGFGYVRF 170


>BT001495-1|AAN71250.1|  350|Drosophila melanogaster LD30815p
           protein.
          Length = 350

 Score = 35.5 bits (78), Expect = 0.054
 Identities = 18/50 (36%), Positives = 30/50 (60%)
 Frame = +2

Query: 89  KLFVGGLSWETSQENLQRYFSRYGEVIDCVVMKNSESGRSRGFGFVTFAD 238
           +++VGGL +   + +L+R+F  YG   D +++KN       G+GFV F D
Sbjct: 5   RVYVGGLPYGVRERDLERFFKGYGRTRD-ILIKN-------GYGFVEFED 46


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 25,826,569
Number of Sequences: 53049
Number of extensions: 567677
Number of successful extensions: 2561
Number of sequences better than 10.0: 490
Number of HSP's better than 10.0 without gapping: 1800
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2409
length of database: 24,988,368
effective HSP length: 81
effective length of database: 20,691,399
effective search space used: 2358819486
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -