SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov2p23
         (399 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT024947-1|ABE01177.1|  385|Drosophila melanogaster IP15954p pro...    81   7e-16
AE014296-1888|AAF50108.2|  385|Drosophila melanogaster CG33048-P...    81   7e-16
AE014296-1887|AAN11896.1|  565|Drosophila melanogaster CG33048-P...    81   7e-16
AF214021-1|AAF67855.1|  385|Drosophila melanogaster molybdenum c...    80   9e-16
AY118620-1|AAM49989.1| 1394|Drosophila melanogaster LP11788p pro...    29   2.3  
AE014297-4145|AAF56722.1| 1511|Drosophila melanogaster CG5639-PA...    29   2.3  
AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P...    28   5.3  
BT022343-1|AAY54759.1|  216|Drosophila melanogaster IP08324p pro...    27   7.0  
BT022303-1|AAY54719.1|  222|Drosophila melanogaster IP08224p pro...    27   7.0  
BT022243-1|AAY54659.1|  216|Drosophila melanogaster IP08124p pro...    27   7.0  
U00180-1|AAC46462.1|  760|Drosophila melanogaster E(z) protein.        27   9.2  
AY052072-1|AAK93496.1| 2409|Drosophila melanogaster SD02860p pro...    27   9.2  
AY051785-1|AAK93209.1|  760|Drosophila melanogaster LD30505p pro...    27   9.2  
AJ309005-1|CAC35209.1| 2382|Drosophila melanogaster GRAAL2 prote...    27   9.2  
AE014296-1830|AAF50149.1|  760|Drosophila melanogaster CG6502-PA...    27   9.2  

>BT024947-1|ABE01177.1|  385|Drosophila melanogaster IP15954p
           protein.
          Length = 385

 Score = 80.6 bits (190), Expect = 7e-16
 Identities = 38/70 (54%), Positives = 41/70 (58%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+D  GR H YLRISLTERCNLRC YCMPAEGVP               +       GV 
Sbjct: 61  LTDSFGRHHTYLRISLTERCNLRCDYCMPAEGVPLQPKNKLLTTEEILRLARIFVEQGVR 120

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 121 KIRLTGGEPT 130


>AE014296-1888|AAF50108.2|  385|Drosophila melanogaster CG33048-PA,
           isoform A protein.
          Length = 385

 Score = 80.6 bits (190), Expect = 7e-16
 Identities = 38/70 (54%), Positives = 41/70 (58%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+D  GR H YLRISLTERCNLRC YCMPAEGVP               +       GV 
Sbjct: 61  LTDSFGRHHTYLRISLTERCNLRCDYCMPAEGVPLQPKNKLLTTEEILRLARIFVEQGVR 120

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 121 KIRLTGGEPT 130


>AE014296-1887|AAN11896.1|  565|Drosophila melanogaster CG33048-PC,
           isoform C protein.
          Length = 565

 Score = 80.6 bits (190), Expect = 7e-16
 Identities = 38/70 (54%), Positives = 41/70 (58%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+D  GR H YLRISLTERCNLRC YCMPAEGVP               +       GV 
Sbjct: 61  LTDSFGRHHTYLRISLTERCNLRCDYCMPAEGVPLQPKNKLLTTEEILRLARIFVEQGVR 120

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 121 KIRLTGGEPT 130


>AF214021-1|AAF67855.1|  385|Drosophila melanogaster molybdenum
           cofactor synthesis-step 1 protein A splice type I
           protein.
          Length = 385

 Score = 80.2 bits (189), Expect = 9e-16
 Identities = 38/70 (54%), Positives = 41/70 (58%)
 Frame = +3

Query: 189 LSDLHGRRHNYLRISLTERCNLRCKYCMPAEGVPXXXXXXXXXXXXXXXIXGALAAAGVD 368
           L+D  GR H YLRISLTERCNLRC YCMPAEGVP               +       GV 
Sbjct: 61  LTDSFGRHHTYLRISLTERCNLRCDYCMPAEGVPLQPKNKLLTTEEILRLARIFVDQGVR 120

Query: 369 KLRXTGGEPT 398
           K+R TGGEPT
Sbjct: 121 KIRLTGGEPT 130


>AY118620-1|AAM49989.1| 1394|Drosophila melanogaster LP11788p
           protein.
          Length = 1394

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 6/52 (11%)
 Frame = +1

Query: 151 CTVMTAVWRRRPH*ATYMV------VDTTTCEYLSLSDATCDASTACRRKAC 288
           C  + A   R+P    Y+V      +D  TC Y   +DA CD +  C    C
Sbjct: 655 CPPVPACLPRKPGQCPYLVPPGPDNLDANTCAYECRTDAHCDGARRCCSNGC 706


>AE014297-4145|AAF56722.1| 1511|Drosophila melanogaster CG5639-PA
           protein.
          Length = 1511

 Score = 29.1 bits (62), Expect = 2.3
 Identities = 16/52 (30%), Positives = 22/52 (42%), Gaps = 6/52 (11%)
 Frame = +1

Query: 151 CTVMTAVWRRRPH*ATYMV------VDTTTCEYLSLSDATCDASTACRRKAC 288
           C  + A   R+P    Y+V      +D  TC Y   +DA CD +  C    C
Sbjct: 772 CPPVPACLPRKPGQCPYLVPPGPDNLDANTCAYECRTDAHCDGARRCCSNGC 823


>AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB
            protein.
          Length = 23015

 Score = 27.9 bits (59), Expect = 5.3
 Identities = 13/32 (40%), Positives = 17/32 (53%)
 Frame = +1

Query: 238  LSDATCDASTACRRKACPCPVAARCCQWKSCG 333
            LSDA C AS +C+   C  P    C +  +CG
Sbjct: 2439 LSDADCPASASCQNSRCRSP----CERQNACG 2466



 Score = 27.9 bits (59), Expect = 5.3
 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 2/35 (5%)
 Frame = +1

Query: 232  LSLSDATCDASTACRRKAC--PCPVAARCCQWKSC 330
            + L DA C AS ACR+  C  PC  A  C     C
Sbjct: 3826 ICLRDAGCPASQACRKLKCVDPCEFAT-CAPNSPC 3859



 Score = 27.5 bits (58), Expect = 7.0
 Identities = 12/44 (27%), Positives = 18/44 (40%), Gaps = 2/44 (4%)
 Frame = +1

Query: 205  VVDTTTCEYLSLSDATCDASTACRRKAC--PCPVAARCCQWKSC 330
            + +   C+    +D +C    AC  K C  PC    +C Q   C
Sbjct: 3253 ICENRMCQTGCRTDLSCATDEACVNKKCQNPCRTPGQCGQCADC 3296



 Score = 27.1 bits (57), Expect = 9.2
 Identities = 11/35 (31%), Positives = 15/35 (42%)
 Frame = +1

Query: 193  ATYMVVDTTTCEYLSLSDATCDASTACRRKACPCP 297
            A YM +    CE+  +  AT   +    R  C CP
Sbjct: 8540 ACYMGLCQDPCEFAKICAATAKCTAKSHRPVCTCP 8574


>BT022343-1|AAY54759.1|  216|Drosophila melanogaster IP08324p
           protein.
          Length = 216

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = -1

Query: 213 VDDHVGRLMRPPPPHGC 163
           +DD   +++RPPPPH C
Sbjct: 192 LDDSGQQVIRPPPPHEC 208


>BT022303-1|AAY54719.1|  222|Drosophila melanogaster IP08224p
           protein.
          Length = 222

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = -1

Query: 213 VDDHVGRLMRPPPPHGC 163
           +DD   +++RPPPPH C
Sbjct: 192 LDDSGQQVIRPPPPHEC 208


>BT022243-1|AAY54659.1|  216|Drosophila melanogaster IP08124p
           protein.
          Length = 216

 Score = 27.5 bits (58), Expect = 7.0
 Identities = 9/17 (52%), Positives = 13/17 (76%)
 Frame = -1

Query: 213 VDDHVGRLMRPPPPHGC 163
           +DD   +++RPPPPH C
Sbjct: 192 LDDSGQQVIRPPPPHEC 208


>U00180-1|AAC46462.1|  760|Drosophila melanogaster E(z) protein.
          Length = 760

 Score = 27.1 bits (57), Expect = 9.2
 Identities = 10/26 (38%), Positives = 11/26 (42%)
 Frame = +1

Query: 253 CDASTACRRKACPCPVAARCCQWKSC 330
           C     C  K CPC +A R C    C
Sbjct: 575 CRCKAQCNTKQCPCYLAVRECDPDLC 600


>AY052072-1|AAK93496.1| 2409|Drosophila melanogaster SD02860p
           protein.
          Length = 2409

 Score = 27.1 bits (57), Expect = 9.2
 Identities = 14/53 (26%), Positives = 21/53 (39%)
 Frame = +1

Query: 118 RVSGLLLYPIDCTVMTAVWRRRPH*ATYMVVDTTTCEYLSLSDATCDASTACR 276
           +  GL L+P DCT     W ++       +   T  E  S S+  C     C+
Sbjct: 142 QAQGLYLHPFDCTKYVRCWNQQT-----FIESCTPGEIFSFSNQKCVPKEQCK 189


>AY051785-1|AAK93209.1|  760|Drosophila melanogaster LD30505p
           protein.
          Length = 760

 Score = 27.1 bits (57), Expect = 9.2
 Identities = 10/26 (38%), Positives = 11/26 (42%)
 Frame = +1

Query: 253 CDASTACRRKACPCPVAARCCQWKSC 330
           C     C  K CPC +A R C    C
Sbjct: 575 CRCKAQCNTKQCPCYLAVRECDPDLC 600


>AJ309005-1|CAC35209.1| 2382|Drosophila melanogaster GRAAL2 protein
           protein.
          Length = 2382

 Score = 27.1 bits (57), Expect = 9.2
 Identities = 14/53 (26%), Positives = 21/53 (39%)
 Frame = +1

Query: 118 RVSGLLLYPIDCTVMTAVWRRRPH*ATYMVVDTTTCEYLSLSDATCDASTACR 276
           +  GL L+P DCT     W ++       +   T  E  S S+  C     C+
Sbjct: 524 QAQGLYLHPFDCTKYVRCWNQQT-----FIESCTPGEIFSFSNQKCVPKEQCK 571


>AE014296-1830|AAF50149.1|  760|Drosophila melanogaster CG6502-PA
           protein.
          Length = 760

 Score = 27.1 bits (57), Expect = 9.2
 Identities = 10/26 (38%), Positives = 11/26 (42%)
 Frame = +1

Query: 253 CDASTACRRKACPCPVAARCCQWKSC 330
           C     C  K CPC +A R C    C
Sbjct: 575 CRCKAQCNTKQCPCYLAVRECDPDLC 600


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,114,706
Number of Sequences: 53049
Number of extensions: 388104
Number of successful extensions: 1147
Number of sequences better than 10.0: 15
Number of HSP's better than 10.0 without gapping: 1064
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1143
length of database: 24,988,368
effective HSP length: 77
effective length of database: 20,903,595
effective search space used: 1149697725
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -