SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120043.Seq
         (810 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT003311-1|AAO25071.1|  138|Drosophila melanogaster GH04968p pro...    48   2e-05
Y17917-1|CAA76937.1|  405|Drosophila melanogaster calcium/calmod...    47   4e-05
BT001637-1|AAN71392.1|  405|Drosophila melanogaster RE39750p pro...    47   4e-05
AE014135-82|AAF59343.1|  405|Drosophila melanogaster CG1495-PG, ...    47   4e-05
AE014135-81|AAN06533.1|  405|Drosophila melanogaster CG1495-PE, ...    47   4e-05
AE014135-80|AAN06532.1|  405|Drosophila melanogaster CG1495-PC, ...    47   4e-05
AE014135-79|AAF59344.2|  405|Drosophila melanogaster CG1495-PB, ...    47   4e-05
AE014135-78|AAN06531.1|  405|Drosophila melanogaster CG1495-PA, ...    47   4e-05
L28945-1|AAA50509.1|  910|Drosophila melanogaster p90 ribosomal ...    46   5e-05
BT004472-1|AAO42636.1|  892|Drosophila melanogaster SD05277p pro...    46   5e-05
AE014298-3193|AAF50945.1|  911|Drosophila melanogaster CG17596-P...    46   5e-05
AY047563-1|AAK77295.1| 1721|Drosophila melanogaster GH07636p pro...    44   2e-04
AF047475-1|AAC27550.1| 6658|Drosophila melanogaster projectin pr...    44   2e-04
AF023484-1|AAB81836.1|  684|Drosophila melanogaster putative KP7...    44   2e-04
AE014297-1284|AAF54627.1|  705|Drosophila melanogaster CG6715-PA...    44   2e-04
AE014135-137|AAS64601.1| 8647|Drosophila melanogaster CG32019-PE...    44   2e-04
AE014135-136|AAS64600.1| 8648|Drosophila melanogaster CG32019-PC...    44   2e-04
AE014135-135|AAS64599.1| 8930|Drosophila melanogaster CG32019-PD...    44   2e-04
AE014135-134|AAF59316.4| 8943|Drosophila melanogaster CG32019-PA...    44   2e-04
U29608-1|AAA70336.1| 1099|Drosophila melanogaster LATS protein.        43   4e-04
M74583-1|AAA51459.1|  490|Drosophila melanogaster calmodulin-dep...    43   4e-04
L39837-1|AAA73959.1| 1099|Drosophila melanogaster tumor suppress...    43   4e-04
BT029114-1|ABJ17047.1|  379|Drosophila melanogaster IP15240p pro...    43   4e-04
BT010033-1|AAQ22502.1| 1180|Drosophila melanogaster LP05937p pro...    43   4e-04
AY095088-1|AAM11416.1|  748|Drosophila melanogaster RE56868p pro...    43   4e-04
AE014297-4663|AAF57085.1| 1105|Drosophila melanogaster CG12072-P...    43   4e-04
AE014297-1132|AAS65135.1| 1180|Drosophila melanogaster CG11870-P...    43   4e-04
AE014297-1131|AAS65134.1| 1427|Drosophila melanogaster CG11870-P...    43   4e-04
AE014297-1130|AAF54517.3| 1427|Drosophila melanogaster CG11870-P...    43   4e-04
AE014297-1129|AAF54516.3| 1427|Drosophila melanogaster CG11870-P...    43   4e-04
AE014135-177|AAN06568.2|  530|Drosophila melanogaster CG18069-PD...    43   4e-04
AE014135-176|AAX53595.1|  516|Drosophila melanogaster CG18069-PG...    43   4e-04
AE014135-175|AAN06569.2|  509|Drosophila melanogaster CG18069-PE...    43   4e-04
AE014135-174|AAF59390.2|  509|Drosophila melanogaster CG18069-PB...    43   4e-04
AE014135-173|AAF59389.3|  490|Drosophila melanogaster CG18069-PC...    43   4e-04
AE014135-172|AAF59388.3|  490|Drosophila melanogaster CG18069-PA...    43   4e-04
AE013599-38|EAA45999.1|  421|Drosophila melanogaster CG17528-PB,...    43   4e-04
AE013599-37|EAA45998.1|  421|Drosophila melanogaster CG17528-PA,...    43   4e-04
AE013599-36|EAA46000.1|  748|Drosophila melanogaster CG17528-PD,...    43   4e-04
AE013599-35|EAA45997.1|  748|Drosophila melanogaster CG17528-PC,...    43   4e-04
Z35103-1|CAA84486.1|  455|Drosophila melanogaster Ndr protein ki...    42   8e-04
BT016074-1|AAV36959.1|  582|Drosophila melanogaster LP06206p pro...    42   8e-04
BT011020-1|AAR30180.1|  833|Drosophila melanogaster RE47050p pro...    42   8e-04
BT009940-1|AAQ22409.1| 1046|Drosophila melanogaster SD05712p pro...    42   8e-04
AY058265-1|AAL13494.1| 1075|Drosophila melanogaster GH01890p pro...    42   8e-04
AY051880-1|AAK93304.1|  459|Drosophila melanogaster LD37189p pro...    42   8e-04
AL023893-2|CAA19653.1|  582|Drosophila melanogaster EG:132E8.2,F...    42   8e-04
AF387636-1|AAK82366.1| 1058|Drosophila melanogaster Ser/Thr prot...    42   8e-04
AF387635-1|AAK82365.1|  832|Drosophila melanogaster Ser/Thr prot...    42   8e-04
AF258462-1|AAF69801.1|  938|Drosophila melanogaster PAR-1 protein.     42   8e-04
AF247814-1|AAF97511.1|  463|Drosophila melanogaster NDR kinase p...    42   8e-04
AF239171-1|AAF67168.1|  455|Drosophila melanogaster NDR protein ...    42   8e-04
AF238490-1|AAF67167.1|  459|Drosophila melanogaster NDR protein ...    42   8e-04
AF020310-1|AAB71398.1|  582|Drosophila melanogaster SNF1A/AMP-ac...    42   8e-04
AF020309-1|AAB71397.1|  582|Drosophila melanogaster SNF1A/AMP-ac...    42   8e-04
AE014298-193|AAS65245.1|  582|Drosophila melanogaster CG3051-PC,...    42   8e-04
AE014298-192|AAN09043.1|  582|Drosophila melanogaster CG3051-PB,...    42   8e-04
AE014298-191|AAF45614.1|  582|Drosophila melanogaster CG3051-PA,...    42   8e-04
AE014296-3228|AAF49104.1|  459|Drosophila melanogaster CG8637-PA...    42   8e-04
AE013599-2911|AAM68417.1| 1033|Drosophila melanogaster CG8201-PE...    42   8e-04
AE013599-2910|AAX52693.1| 1060|Drosophila melanogaster CG8201-PM...    42   8e-04
AE013599-2909|AAF57548.2| 1060|Drosophila melanogaster CG8201-PD...    42   8e-04
AE013599-2908|AAF57550.2| 1060|Drosophila melanogaster CG8201-PC...    42   8e-04
AE013599-2907|AAF57549.2| 1098|Drosophila melanogaster CG8201-PF...    42   8e-04
AE013599-2906|AAS64804.1| 1138|Drosophila melanogaster CG8201-PG...    42   8e-04
AE013599-2904|AAS64803.1|  993|Drosophila melanogaster CG8201-PO...    42   8e-04
AE013599-2903|AAS64802.1|  993|Drosophila melanogaster CG8201-PJ...    42   8e-04
AE013599-2902|AAS64801.1|  993|Drosophila melanogaster CG8201-PI...    42   8e-04
AE013599-2901|AAS64800.1|  993|Drosophila melanogaster CG8201-PH...    42   8e-04
AE013599-2900|AAX52691.1|  833|Drosophila melanogaster CG8201-PN...    42   8e-04
AE013599-2899|AAX52690.1|  833|Drosophila melanogaster CG8201-PL...    42   8e-04
AE013599-2898|AAS64799.1|  905|Drosophila melanogaster CG8201-PB...    42   8e-04
AE013599-2897|AAS64798.1|  938|Drosophila melanogaster CG8201-PA...    42   8e-04
AY113251-1|AAM29256.1|  411|Drosophila melanogaster AT13713p pro...    42   0.001
AE014297-3333|AAF56141.1|  411|Drosophila melanogaster CG10177-P...    42   0.001
AE014296-2593|AAF49569.3|  861|Drosophila melanogaster CG6114-PA...    42   0.001
AY118659-1|AAM50028.1| 1571|Drosophila melanogaster SD09178p pro...    40   0.004
AY089322-1|AAL90060.1|  604|Drosophila melanogaster AT13327p pro...    40   0.004
AF023484-2|AAB81837.1|  604|Drosophila melanogaster putative KP7...    40   0.004
AE014297-2578|AAF55592.1| 1612|Drosophila melanogaster CG7717-PA...    40   0.004
AE014297-2577|AAN13787.1| 1571|Drosophila melanogaster CG7717-PB...    40   0.004
AE014297-1283|AAF54626.1|  604|Drosophila melanogaster CG17216-P...    40   0.004
AB069962-1|BAB62892.1| 1497|Drosophila melanogaster mekk1b protein.    40   0.004
AB069961-1|BAB62891.1| 1571|Drosophila melanogaster mekk1a protein.    40   0.004
BT021340-1|AAX33488.1|  835|Drosophila melanogaster LP23904p pro...    38   0.012
BT001553-1|AAN71308.1|  284|Drosophila melanogaster RE12039p pro...    38   0.012
AY129445-1|AAM76187.1|  855|Drosophila melanogaster LD18893p pro...    38   0.012
AY069806-1|AAL39951.1| 1157|Drosophila melanogaster SD04681p pro...    38   0.012
AY060835-1|AAL28383.1|  422|Drosophila melanogaster GM01879p pro...    38   0.012
AE014296-3555|AAN12171.1| 1157|Drosophila melanogaster CG7597-PB...    38   0.012
AE014296-3554|AAF51738.1| 1157|Drosophila melanogaster CG7597-PA...    38   0.012
AE014296-2189|AAF49878.1|  835|Drosophila melanogaster CG10967-P...    38   0.012
AE014135-84|AAN06535.1|  284|Drosophila melanogaster CG1495-PH, ...    38   0.012
AE014135-83|AAN06534.1|  284|Drosophila melanogaster CG1495-PD, ...    38   0.012
AY052023-1|AAK93447.1|  639|Drosophila melanogaster LD47563p pro...    38   0.016
AJ011578-1|CAA09699.1|  639|Drosophila melanogaster p21 activate...    38   0.016
AF031517-1|AAD01935.1|  639|Drosophila melanogaster Ste20 serine...    38   0.016
AE014298-2430|AAF48629.2|  639|Drosophila melanogaster CG18582-P...    38   0.016
AE014297-3638|AAF56344.1|  841|Drosophila melanogaster CG10951-P...    38   0.016
BT025098-1|ABE73269.1|  670|Drosophila melanogaster IP12358p pro...    37   0.028
AY060726-1|AAL28274.1|  446|Drosophila melanogaster GH17420p pro...    37   0.028
AE014296-2154|AAF49907.2| 1854|Drosophila melanogaster CG10522-P...    37   0.028
AE013599-915|AAF58906.3|  446|Drosophila melanogaster CG1776-PA ...    37   0.028
AY060800-1|AAL28348.1|  985|Drosophila melanogaster GH26463p pro...    37   0.038
AE013599-3767|AAF47129.2|  985|Drosophila melanogaster CG3105-PA...    37   0.038
X83466-1|CAA58469.1|  421|Drosophila melanogaster aurora protein.      36   0.050
X83465-1|CAA58468.1|  421|Drosophila melanogaster aurora protein.      36   0.050
AY061229-1|AAL28777.1|  411|Drosophila melanogaster LD16949p pro...    36   0.050
AE014297-1411|AAF54723.1|  411|Drosophila melanogaster CG3068-PA...    36   0.050
U56080-1|AAB01209.1|  704|Drosophila melanogaster p21-activated ...    36   0.066
U20757-1|AAA86885.1|  359|Drosophila melanogaster MAP kinase act...    36   0.066
AY095014-1|AAM11342.1|  860|Drosophila melanogaster GH25405p pro...    36   0.066
AY069813-1|AAL39958.1|  201|Drosophila melanogaster SD05481p pro...    36   0.066
AY060397-1|AAL25436.1|  317|Drosophila melanogaster LD31205p pro...    36   0.066
AY052073-1|AAK93497.1|  860|Drosophila melanogaster SD02969p pro...    36   0.066
AL031765-7|CAA21125.1| 1398|Drosophila melanogaster EG:22E5.8 pr...    36   0.066
AE014298-792|AAF46078.3|  359|Drosophila melanogaster CG3086-PD,...    36   0.066
AE014298-791|AAN09152.1|  359|Drosophila melanogaster CG3086-PC,...    36   0.066
AE014298-790|AAG22408.1|  359|Drosophila melanogaster CG3086-PB,...    36   0.066
AE014298-317|AAF45711.1| 1398|Drosophila melanogaster CG4290-PA ...    36   0.066
AE013599-2311|AAM68505.1|  317|Drosophila melanogaster CG5072-PC...    36   0.066
AE013599-2310|AAF57981.1|  317|Drosophila melanogaster CG5072-PB...    36   0.066
AE013599-2309|AAF57980.1|  317|Drosophila melanogaster CG5072-PA...    36   0.066
AE013599-1854|AAM70996.1|  860|Drosophila melanogaster CG8485-PD...    36   0.066
AE013599-1853|AAM70995.1|  860|Drosophila melanogaster CG8485-PC...    36   0.066
AE013599-1852|AAM70994.1|  860|Drosophila melanogaster CG8485-PB...    36   0.066
AE013599-1851|AAF58274.1|  860|Drosophila melanogaster CG8485-PA...    36   0.066
BT010086-1|AAQ22555.1|  630|Drosophila melanogaster LD04521p pro...    36   0.087
AJ577475-1|CAE12059.1| 1342|Drosophila melanogaster polo kinase ...    36   0.087
AE014297-2385|AAF55450.1|  630|Drosophila melanogaster CG7643-PA...    36   0.087
AE013599-3861|AAM68311.1| 1300|Drosophila melanogaster CG4527-PA...    36   0.087
AE013599-3860|AAS64767.1| 1703|Drosophila melanogaster CG4527-PD...    36   0.087
AE013599-3859|AAS64766.1| 1703|Drosophila melanogaster CG4527-PC...    36   0.087
AE013599-3858|AAF47198.2| 1703|Drosophila melanogaster CG4527-PB...    36   0.087
AE013599-3857|AAX52684.1| 1342|Drosophila melanogaster CG4527-PE...    36   0.087
X99510-1|CAA67860.1|  317|Drosophila melanogaster CDK4/6 kinase ...    35   0.11 
X63361-1|CAA44963.1|  576|Drosophila melanogaster protein kinase...    35   0.11 
U49446-1|AAC47094.1|  704|Drosophila melanogaster serine/threoni...    35   0.11 
BT010291-1|AAQ23609.1|  704|Drosophila melanogaster LD20767p pro...    35   0.11 
BT003294-1|AAO25054.1|  460|Drosophila melanogaster GH27460p pro...    35   0.11 
AY119163-1|AAM51023.1|  460|Drosophila melanogaster RH22541p pro...    35   0.11 
AY095028-1|AAM11356.1|  576|Drosophila melanogaster LD11851p pro...    35   0.11 
AY071688-1|AAL49310.1|  947|Drosophila melanogaster RH10407p pro...    35   0.11 
AE014297-447|AAN13373.1|  704|Drosophila melanogaster CG10295-PC...    35   0.11 
AE014297-446|AAF54132.1|  704|Drosophila melanogaster CG10295-PB...    35   0.11 
AE014297-445|AAF54131.1|  704|Drosophila melanogaster CG10295-PA...    35   0.11 
AE014296-3322|AAX52738.1|  576|Drosophila melanogaster CG12306-P...    35   0.11 
AE014296-3321|AAF49036.1|  576|Drosophila melanogaster CG12306-P...    35   0.11 
AE014134-197|AAS64629.1|  460|Drosophila melanogaster CG4629-PC,...    35   0.11 
AE014134-196|AAN10479.2|  534|Drosophila melanogaster CG4629-PB,...    35   0.11 
AE014134-195|AAF51422.3|  534|Drosophila melanogaster CG4629-PA,...    35   0.11 
AE013599-2836|AAM70845.1|  947|Drosophila melanogaster CG7097-PB...    35   0.11 
AE013599-2835|AAF57595.1| 1218|Drosophila melanogaster CG7097-PA...    35   0.11 
X57486-1|CAA40724.1|  314|Drosophila melanogaster p34-cdc2 homol...    35   0.15 
BT021275-1|AAX33423.1|  671|Drosophila melanogaster RE44754p pro...    35   0.15 
AY051671-1|AAK93095.1|  314|Drosophila melanogaster LD22351p pro...    35   0.15 
AE014298-1764|AAF48160.3|  671|Drosophila melanogaster CG10524-P...    35   0.15 
AE014297-2847|AAF55799.1|  314|Drosophila melanogaster CG10498-P...    35   0.15 
AE014297-2846|AAN14363.1|  314|Drosophila melanogaster CG10498-P...    35   0.15 
D89663-1|BAA20906.1|  832|Drosophila melanogaster myosin light c...    34   0.20 
D89661-1|BAA19488.1|  929|Drosophila melanogaster myosin light c...    34   0.20 
BT004846-1|AAO45202.1|  769|Drosophila melanogaster RE70136p pro...    34   0.20 
AY058648-1|AAL13877.1|  846|Drosophila melanogaster LD35132p pro...    34   0.20 
AF255671-1|AAG01798.1|  732|Drosophila melanogaster Stretchin-ML...    34   0.20 
AF255670-1|AAG01797.1|  786|Drosophila melanogaster Stretchin-ML...    34   0.20 
AF255669-1|AAG01796.1|  623|Drosophila melanogaster Stretchin-ML...    34   0.20 
AF255668-1|AAG01795.1|  577|Drosophila melanogaster Stretchin-ML...    34   0.20 
AF106952-1|AAD19607.1|  769|Drosophila melanogaster serine/threo...    34   0.20 
AE014297-2580|AAF55594.2|  846|Drosophila melanogaster CG7719-PA...    34   0.20 
AE014296-3553|AAF51737.1|  769|Drosophila melanogaster CG7186-PA...    34   0.20 
AE013599-2145|AAM70938.1|  785|Drosophila melanogaster CG18255-P...    34   0.20 
AE013599-2144|AAF58089.2|  929|Drosophila melanogaster CG18255-P...    34   0.20 
AE013599-2143|AAF58090.2| 1506|Drosophila melanogaster CG18255-P...    34   0.20 
AE013599-2142|AAM70937.1| 4463|Drosophila melanogaster CG18255-P...    34   0.20 
AE013599-2141|AAM70936.1| 9270|Drosophila melanogaster CG18255-P...    34   0.20 
U13014-1|AAA64560.1|  560|Drosophila melanogaster phosphorylase ...    34   0.26 
AY051698-1|AAK93122.1| 1637|Drosophila melanogaster LD24220p pro...    34   0.26 
AY051635-1|AAK93059.1|  419|Drosophila melanogaster GH28523p pro...    34   0.26 
AY051575-1|AAK92999.1|  560|Drosophila melanogaster GH22314p pro...    34   0.26 
AF029395-1|AAB96643.1| 1613|Drosophila melanogaster Genghis Khan...    34   0.26 
AE014298-1665|AAF48077.2|  502|Drosophila melanogaster CG1830-PC...    34   0.26 
AE014298-1664|AAG22343.2|  502|Drosophila melanogaster CG1830-PA...    34   0.26 
AE014298-1663|AAN09640.1|  419|Drosophila melanogaster CG1830-PB...    34   0.26 
AE013599-3814|AAF47163.1| 1637|Drosophila melanogaster CG4012-PA...    34   0.26 
X16961-1|CAA34835.1|  502|Drosophila melanogaster protein ( Dros...    33   0.46 
AY118681-1|AAM50541.1|  585|Drosophila melanogaster AT10577p pro...    33   0.46 
AE014296-2595|AAF49568.2|  500|Drosophila melanogaster CG6117-PA...    33   0.46 
AE014296-2594|AAN11771.2|  583|Drosophila melanogaster CG6117-PB...    33   0.46 
AF142061-1|AAD48407.1| 1207|Drosophila melanogaster protein kina...    33   0.61 
AE014296-1893|AAF50105.1| 1207|Drosophila melanogaster CG6297-PB...    33   0.61 
AE014296-1892|AAN11898.1| 1207|Drosophila melanogaster CG6297-PA...    33   0.61 
X94264-1|CAA63940.1|  571|Drosophila melanogaster calcium /calmo...    32   0.81 
AE014297-3042|AAF55922.2|  898|Drosophila melanogaster CG6703-PB...    32   0.81 
U53190-1|AAC80169.1|  897|Drosophila melanogaster Camguk protein.      32   1.1  
U67304-1|AAC47429.1|  637|Drosophila melanogaster 70 kDa S6 kina...    31   1.4  
U66562-1|AAC47312.4|  490|Drosophila melanogaster p70s6k protein...    31   1.4  
BT011183-1|AAR88544.1|  603|Drosophila melanogaster RE17878p pro...    31   1.4  
AY095090-1|AAM11418.1|  247|Drosophila melanogaster RE65159p pro...    31   1.4  
AY075222-1|AAL68089.1|  390|Drosophila melanogaster AT17410p pro...    31   1.4  
AE014296-2536|AAF49616.1| 2139|Drosophila melanogaster CG6498-PA...    31   1.4  
AE014296-1014|AAF50742.1|  490|Drosophila melanogaster CG10539-P...    31   1.4  
AE014134-2867|AAF53630.2|  390|Drosophila melanogaster CG7094-PA...    31   1.4  
AE014134-1728|AAF52832.2|  659|Drosophila melanogaster CG31711-P...    31   1.4  
AY118312-1|AAM48341.1|  836|Drosophila melanogaster GH26429p pro...    31   1.9  
AE014297-2501|AAN13770.3|  836|Drosophila melanogaster CG7125-PD...    31   1.9  
AE014297-2500|AAF55537.4|  836|Drosophila melanogaster CG7125-PC...    31   1.9  
AE014297-2499|AAN13769.3|  836|Drosophila melanogaster CG7125-PB...    31   1.9  
AE014297-2498|AAF55536.4|  836|Drosophila melanogaster CG7125-PA...    31   1.9  
D89662-1|BAA19489.1|  569|Drosophila melanogaster myosin light c...    31   2.5  
AE014297-3225|AAF56055.2|  258|Drosophila melanogaster CG4803-PA...    31   2.5  
AE014296-475|AAS64945.1| 1102|Drosophila melanogaster CG16973-PD...    31   2.5  
AE014296-474|AAS64944.1| 1102|Drosophila melanogaster CG16973-PC...    31   2.5  
AE014296-473|AAS64943.1| 1042|Drosophila melanogaster CG16973-PE...    31   2.5  
AE014296-472|AAF47658.3| 1504|Drosophila melanogaster CG16973-PA...    31   2.5  
AE014296-471|AAS64942.1| 1200|Drosophila melanogaster CG16973-PB...    31   2.5  
AY118401-1|AAM48430.1|  828|Drosophila melanogaster RE60792p pro...    30   3.3  
AY095005-1|AAM11333.1|  695|Drosophila melanogaster GH08190p pro...    30   3.3  
AY094630-1|AAM10983.1|  749|Drosophila melanogaster AT02150p pro...    30   3.3  
AF005239-1|AAC23709.1|  460|Drosophila melanogaster DEAD-box hel...    30   3.3  
AE014296-3664|AAF51819.2|  749|Drosophila melanogaster CG11489-P...    30   3.3  
AE014296-3663|AAF51818.3|  816|Drosophila melanogaster CG11489-P...    30   3.3  
AE014135-217|ABC65841.1|  828|Drosophila melanogaster CG40478-PE...    30   3.3  
AE014135-216|ABC65840.1|  828|Drosophila melanogaster CG40478-PD...    30   3.3  
AE014135-215|ABC65839.1|  828|Drosophila melanogaster CG40478-PC...    30   3.3  
AE014135-214|ABC65838.1|  828|Drosophila melanogaster CG40478-PB...    30   3.3  
AE014135-213|ABC65837.1|  828|Drosophila melanogaster CG40478-PA...    30   3.3  
L42962-1|AAC37267.1|  650|Drosophila melanogaster protein kinase...    30   4.3  
AE014297-2723|AAS65178.1| 1196|Drosophila melanogaster CG4720-PB...    30   4.3  
AE014297-2722|AAF55711.2| 1367|Drosophila melanogaster CG4720-PA...    30   4.3  
AB038236-1|BAC16514.1| 1367|Drosophila melanogaster DASK1 protein.     30   4.3  
U73196-1|AAC47325.1|  353|Drosophila melanogaster Jun-N-terminal...    29   5.7  
U50966-1|AAB51188.1|  315|Drosophila melanogaster DJNK protein.        29   5.7  
U50965-1|AAB51187.1|  372|Drosophila melanogaster DJNK protein.        29   5.7  
U49249-1|AAB48381.1|  372|Drosophila melanogaster JNK protein ki...    29   5.7  
U49180-1|AAB97094.1|  372|Drosophila melanogaster JNK protein ki...    29   5.7  
BT023486-1|AAY84886.1| 1367|Drosophila melanogaster RE60627p pro...    29   5.7  
AY122221-1|AAM52733.1|  372|Drosophila melanogaster RE08746p pro...    29   5.7  
AY070865-1|AAL48487.1|  372|Drosophila melanogaster HL02677p pro...    29   5.7  
AY069129-1|AAL39274.1|  519|Drosophila melanogaster GH13884p pro...    29   5.7  
AY051961-1|AAK93385.1|  512|Drosophila melanogaster LD42896p pro...    29   5.7  
AF215861-1|AAF32288.1|  534|Drosophila melanogaster Myt1 kinase-...    29   5.7  
AF057041-1|AAC13566.1|  513|Drosophila melanogaster Ser/Thr kina...    29   5.7  
AE014296-1005|AAF50747.3|  533|Drosophila melanogaster CG32417-P...    29   5.7  
AE014134-2924|AAF53663.1|  665|Drosophila melanogaster CG5790-PA...    29   5.7  
AE014134-2748|AAF53551.2|  512|Drosophila melanogaster CG17161-P...    29   5.7  
AE014134-2747|AAN10952.1|  512|Drosophila melanogaster CG17161-P...    29   5.7  
AE014134-2746|AAF53552.2|  512|Drosophila melanogaster CG17161-P...    29   5.7  
AE014134-1794|AAF52883.1|  372|Drosophila melanogaster CG5680-PB...    29   5.7  
Y07908-1|CAA69216.1|  752|Drosophila melanogaster serine/threoni...    29   7.5  
X99512-1|CAA67862.1|  509|Drosophila melanogaster serine/threoni...    29   7.5  
U87984-1|AAB49642.1|  459|Drosophila melanogaster ovarian specif...    29   7.5  
D88898-1|BAA85188.1| 1198|Drosophila melanogaster focal adhesion...    29   7.5  
BT022360-1|AAY54776.1|  319|Drosophila melanogaster IP11482p pro...    29   7.5  
BT021255-1|AAX33403.1| 1200|Drosophila melanogaster RE57482p pro...    29   7.5  
BT011471-1|AAR99129.1|  539|Drosophila melanogaster RE18330p pro...    29   7.5  
BT004489-1|AAO42653.1|  755|Drosophila melanogaster LD22131p pro...    29   7.5  
BT001263-1|AAN71019.1|  469|Drosophila melanogaster AT02760p pro...    29   7.5  
AY886895-1|AAY34268.1|  310|Drosophila melanogaster focal adhesi...    29   7.5  
AY070549-1|AAL48020.1|  459|Drosophila melanogaster LD27857p pro...    29   7.5  
AY069508-1|AAL39653.1| 1099|Drosophila melanogaster LD22858p pro...    29   7.5  
AF201701-1|AAF15292.1| 1200|Drosophila melanogaster focal adhesi...    29   7.5  
AF112116-1|AAF07854.1| 1200|Drosophila melanogaster focal adhesi...    29   7.5  
AE014296-12|AAN11418.1|  539|Drosophila melanogaster CG1210-PG, ...    29   7.5  
AE014296-11|AAF47331.1|  539|Drosophila melanogaster CG1210-PE, ...    29   7.5  
AE014296-10|AAF47332.1|  539|Drosophila melanogaster CG1210-PB, ...    29   7.5  
AE014296-9|AAN11417.1|  755|Drosophila melanogaster CG1210-PH, i...    29   7.5  
AE014296-8|AAF47328.1|  755|Drosophila melanogaster CG1210-PF, i...    29   7.5  
AE014296-7|AAF47327.3|  755|Drosophila melanogaster CG1210-PA, i...    29   7.5  
AE014296-6|AAF47329.2|  819|Drosophila melanogaster CG1210-PC, i...    29   7.5  
AE014296-5|AAF47330.3|  836|Drosophila melanogaster CG1210-PD, i...    29   7.5  
AE014134-3193|AAN11063.1|  459|Drosophila melanogaster CG10895-P...    29   7.5  
AE014134-3192|AAN11062.1|  459|Drosophila melanogaster CG10895-P...    29   7.5  
AE014134-3191|AAF53867.2|  476|Drosophila melanogaster CG10895-P...    29   7.5  
AE014134-904|AAF52236.1| 1099|Drosophila melanogaster CG14030-PA...    29   7.5  
AE014134-437|AAF51232.1|  319|Drosophila melanogaster CG9962-PA ...    29   7.5  
AE013599-2884|AAM70853.1| 1200|Drosophila melanogaster CG10023-P...    29   7.5  
AE013599-2883|AAM70852.1| 1200|Drosophila melanogaster CG10023-P...    29   7.5  
AE013599-2882|AAF57562.1| 1200|Drosophila melanogaster CG10023-P...    29   7.5  
AB007822-1|BAA28756.1|  459|Drosophila melanogaster short form o...    29   7.5  
AB007821-1|BAA28755.1|  476|Drosophila melanogaster long form of...    29   7.5  
X99511-1|CAA67861.1|  294|Drosophila melanogaster CDK5 kinase pr...    29   9.9  
X80468-1|CAA56640.1|  805|Drosophila melanogaster serine threoni...    29   9.9  
X55759-1|CAA39285.1|  297|Drosophila melanogaster serine/threoni...    29   9.9  
X16969-1|CAA34840.1|  353|Drosophila melanogaster catalytic subu...    29   9.9  
U21552-1|AAA63754.1|  294|Drosophila melanogaster CDK5 homolog p...    29   9.9  
S69166-1|AAB29841.1|  155|Drosophila melanogaster Fu protein.          29   9.9  
S69165-1|AAB29840.1|  152|Drosophila melanogaster Fu protein.          29   9.9  
M20231-1|AAA28720.1| 1135|Drosophila melanogaster protein ( D.me...    29   9.9  
M20230-1|AAA28721.1| 1501|Drosophila melanogaster protein ( D.me...    29   9.9  
M18655-1|AAA28412.1|  353|Drosophila melanogaster protein ( D.me...    29   9.9  
L34782-1|AAA28552.1|  805|Drosophila melanogaster serine/threoni...    29   9.9  
J03131-2|AAA28719.1| 1135|Drosophila melanogaster protein ( D.me...    29   9.9  
J03131-1|AAA28718.1| 1501|Drosophila melanogaster protein ( D.me...    29   9.9  
BT023514-1|AAY84914.1|  827|Drosophila melanogaster LD03657p pro...    29   9.9  
BT022123-1|AAY51518.1|  509|Drosophila melanogaster IP09007p pro...    29   9.9  
BT010064-1|AAQ22533.1|  509|Drosophila melanogaster LD15250p pro...    29   9.9  
BT003604-1|AAO39607.1| 1191|Drosophila melanogaster GM01778p pro...    29   9.9  
BT001630-1|AAN71385.1|  642|Drosophila melanogaster RE38276p pro...    29   9.9  
AY119496-1|AAM50150.1| 1135|Drosophila melanogaster GH10824p pro...    29   9.9  
AY113367-1|AAM29372.1|  367|Drosophila melanogaster LD27880p pro...    29   9.9  
AY094680-1|AAM11033.1|  743|Drosophila melanogaster GH06335p pro...    29   9.9  
AY089432-1|AAL90170.1|  302|Drosophila melanogaster AT25266p pro...    29   9.9  
AY069425-1|AAL39570.1|  353|Drosophila melanogaster LD13640p pro...    29   9.9  
AY061049-1|AAL28597.1|  294|Drosophila melanogaster LD01910p pro...    29   9.9  
AL009195-7|CAA15704.1|  744|Drosophila melanogaster EG:30B8.6 pr...    29   9.9  
AF152406-1|AAD45517.1|  522|Drosophila melanogaster serine/threo...    29   9.9  
AF152405-1|AAD45516.1|  522|Drosophila melanogaster serine/threo...    29   9.9  
AF152404-1|AAD45515.1|  522|Drosophila melanogaster serine/threo...    29   9.9  
AF152403-1|AAD45514.1|  501|Drosophila melanogaster serine/threo...    29   9.9  
AF152402-1|AAD45513.1|  509|Drosophila melanogaster serine/threo...    29   9.9  
AF152401-1|AAD45512.1|  522|Drosophila melanogaster serine/threo...    29   9.9  
AF152400-1|AAD45511.1|  522|Drosophila melanogaster serine/threo...    29   9.9  
AF152399-1|AAD45510.1|  509|Drosophila melanogaster serine/threo...    29   9.9  
AF152398-1|AAD45509.1|  522|Drosophila melanogaster serine/threo...    29   9.9  
AE014298-2752|AAF48871.1|  805|Drosophila melanogaster CG6551-PA...    29   9.9  
AE014298-373|AAF45763.2|  743|Drosophila melanogaster CG3078-PA ...    29   9.9  
AE014297-2550|AAN13780.1|  302|Drosophila melanogaster CG14305-P...    29   9.9  
AE014297-2549|AAN13779.1|  302|Drosophila melanogaster CG14305-P...    29   9.9  
AE014297-2548|AAF55571.1|  302|Drosophila melanogaster CG14305-P...    29   9.9  
AE014297-2311|AAF55388.1|  642|Drosophila melanogaster CG5169-PA...    29   9.9  
AE014296-681|ABI31233.1|  501|Drosophila melanogaster CG10579-PH...    29   9.9  
AE014296-680|ABI31237.1|  509|Drosophila melanogaster CG10579-PJ...    29   9.9  
AE014296-679|AAG22239.2|  509|Drosophila melanogaster CG10579-PC...    29   9.9  
AE014296-678|AAF47781.2|  509|Drosophila melanogaster CG10579-PB...    29   9.9  
AE014296-677|AAG22238.2|  509|Drosophila melanogaster CG10579-PA...    29   9.9  
AE014296-676|ABI31234.1|  522|Drosophila melanogaster CG10579-PK...    29   9.9  
AE014296-675|ABI31235.1|  522|Drosophila melanogaster CG10579-PI...    29   9.9  
AE014296-674|ABI31236.1|  522|Drosophila melanogaster CG10579-PG...    29   9.9  
AE014296-673|ABI31232.1|  509|Drosophila melanogaster CG10579-PF...    29   9.9  
AE014296-672|AAN11569.1|  522|Drosophila melanogaster CG10579-PE...    29   9.9  
AE014296-671|AAN11568.1|  522|Drosophila melanogaster CG10579-PD...    29   9.9  
AE014134-1676|AAS64669.1|  353|Drosophila melanogaster CG4379-PC...    29   9.9  
AE014134-1675|AAN10703.1|  353|Drosophila melanogaster CG4379-PB...    29   9.9  
AE014134-1674|AAF52797.1|  353|Drosophila melanogaster CG4379-PA...    29   9.9  
AE014134-1264|AAF52505.1| 1135|Drosophila melanogaster CG5125-PA...    29   9.9  
AE014134-1263|AAF52504.3| 1501|Drosophila melanogaster CG5125-PB...    29   9.9  
AE013599-2083|AAF58119.1|  294|Drosophila melanogaster CG8203-PA...    29   9.9  

>BT003311-1|AAO25071.1|  138|Drosophila melanogaster GH04968p
           protein.
          Length = 138

 Score = 48.0 bits (109), Expect = 2e-05
 Identities = 22/80 (27%), Positives = 48/80 (60%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +EI+V + +  HPN +++   +   +   +VM+ +   +LF+ +  KG  + +  S++IR
Sbjct: 40  NEIRVLRRLT-HPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIR 98

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+ EA++ +H+   +H D+K
Sbjct: 99  QILEAVDYMHEQGVVHRDLK 118


>Y17917-1|CAA76937.1|  405|Drosophila melanogaster
           calcium/calmodulin dependent proteinkinase I protein.
          Length = 405

 Score = 46.8 bits (106), Expect = 4e-05
 Identities = 19/69 (27%), Positives = 41/69 (59%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++   +   +   +VM+ +   +LF+ +  KG  + +  S++IRQ+ EA++ +H+
Sbjct: 102 HPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHE 161

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 162 QGVVHRDLK 170


>BT001637-1|AAN71392.1|  405|Drosophila melanogaster RE39750p
           protein.
          Length = 405

 Score = 46.8 bits (106), Expect = 4e-05
 Identities = 19/69 (27%), Positives = 41/69 (59%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++   +   +   +VM+ +   +LF+ +  KG  + +  S++IRQ+ EA++ +H+
Sbjct: 102 HPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHE 161

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 162 QGVVHRDLK 170


>AE014135-82|AAF59343.1|  405|Drosophila melanogaster CG1495-PG,
           isoform G protein.
          Length = 405

 Score = 46.8 bits (106), Expect = 4e-05
 Identities = 19/69 (27%), Positives = 41/69 (59%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++   +   +   +VM+ +   +LF+ +  KG  + +  S++IRQ+ EA++ +H+
Sbjct: 102 HPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHE 161

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 162 QGVVHRDLK 170


>AE014135-81|AAN06533.1|  405|Drosophila melanogaster CG1495-PE,
           isoform E protein.
          Length = 405

 Score = 46.8 bits (106), Expect = 4e-05
 Identities = 19/69 (27%), Positives = 41/69 (59%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++   +   +   +VM+ +   +LF+ +  KG  + +  S++IRQ+ EA++ +H+
Sbjct: 102 HPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHE 161

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 162 QGVVHRDLK 170


>AE014135-80|AAN06532.1|  405|Drosophila melanogaster CG1495-PC,
           isoform C protein.
          Length = 405

 Score = 46.8 bits (106), Expect = 4e-05
 Identities = 19/69 (27%), Positives = 41/69 (59%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++   +   +   +VM+ +   +LF+ +  KG  + +  S++IRQ+ EA++ +H+
Sbjct: 102 HPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHE 161

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 162 QGVVHRDLK 170


>AE014135-79|AAF59344.2|  405|Drosophila melanogaster CG1495-PB,
           isoform B protein.
          Length = 405

 Score = 46.8 bits (106), Expect = 4e-05
 Identities = 19/69 (27%), Positives = 41/69 (59%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++   +   +   +VM+ +   +LF+ +  KG  + +  S++IRQ+ EA++ +H+
Sbjct: 102 HPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHE 161

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 162 QGVVHRDLK 170


>AE014135-78|AAN06531.1|  405|Drosophila melanogaster CG1495-PA,
           isoform A protein.
          Length = 405

 Score = 46.8 bits (106), Expect = 4e-05
 Identities = 19/69 (27%), Positives = 41/69 (59%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN +++   +   +   +VM+ +   +LF+ +  KG  + +  S++IRQ+ EA++ +H+
Sbjct: 102 HPNIVQLLETYEDKSKVYLVMELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHE 161

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 162 QGVVHRDLK 170


>L28945-1|AAA50509.1|  910|Drosophila melanogaster p90 ribosomal S6
           kinase protein.
          Length = 910

 Score = 46.4 bits (105), Expect = 5e-05
 Identities = 18/80 (22%), Positives = 42/80 (52%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +E+++     +HPN + +Y  +    +  +VM+ +   +L + +   G++     S ++R
Sbjct: 616 EEVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLR 675

Query: 61  QLCEALNDLHKHNFIHNDIK 2
            +  A+  LH+H  +H D+K
Sbjct: 676 TIASAVAYLHEHGVVHRDLK 695



 Score = 30.7 bits (66), Expect = 2.5
 Identities = 15/69 (21%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H   +++++         +++D++   DLF  L  +   + + V   + +L  A+N LH 
Sbjct: 257 HAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHT 316

Query: 28  HNFIHNDIK 2
              I+ D+K
Sbjct: 317 LGIIYRDLK 325


>BT004472-1|AAO42636.1|  892|Drosophila melanogaster SD05277p
           protein.
          Length = 892

 Score = 46.4 bits (105), Expect = 5e-05
 Identities = 18/80 (22%), Positives = 42/80 (52%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +E+++     +HPN + +Y  +    +  +VM+ +   +L + +   G++     S ++R
Sbjct: 617 EEVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLR 676

Query: 61  QLCEALNDLHKHNFIHNDIK 2
            +  A+  LH+H  +H D+K
Sbjct: 677 TIASAVAYLHEHGVVHRDLK 696



 Score = 30.7 bits (66), Expect = 2.5
 Identities = 15/69 (21%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H   +++++         +++D++   DLF  L  +   + + V   + +L  A+N LH 
Sbjct: 258 HAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHT 317

Query: 28  HNFIHNDIK 2
              I+ D+K
Sbjct: 318 LGIIYRDLK 326


>AE014298-3193|AAF50945.1|  911|Drosophila melanogaster CG17596-PA
           protein.
          Length = 911

 Score = 46.4 bits (105), Expect = 5e-05
 Identities = 18/80 (22%), Positives = 42/80 (52%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
           +E+++     +HPN + +Y  +    +  +VM+ +   +L + +   G++     S ++R
Sbjct: 617 EEVEIMLRYGNHPNIVTLYSVYEDAGSAYLVMELLKGGELLDRILAVGQMCESEASAVLR 676

Query: 61  QLCEALNDLHKHNFIHNDIK 2
            +  A+  LH+H  +H D+K
Sbjct: 677 TIASAVAYLHEHGVVHRDLK 696



 Score = 30.7 bits (66), Expect = 2.5
 Identities = 15/69 (21%), Positives = 33/69 (47%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           H   +++++         +++D++   DLF  L  +   + + V   + +L  A+N LH 
Sbjct: 258 HAFIVRLHYAFQTPGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALAMNHLHT 317

Query: 28  HNFIHNDIK 2
              I+ D+K
Sbjct: 318 LGIIYRDLK 326


>AY047563-1|AAK77295.1| 1721|Drosophila melanogaster GH07636p protein.
          Length = 1721

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL-VSNIIRQLCEALNDLH 32
            H   I ++      +  +++++++   +LFE +  +G +  +  V N +RQ+CE +  +H
Sbjct: 831  HQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGYVMTEAEVINYMRQICEGIRHMH 890

Query: 31   KHNFIHNDIK 2
            + N IH DIK
Sbjct: 891  EQNIIHLDIK 900


>AF047475-1|AAC27550.1| 6658|Drosophila melanogaster projectin
            protein.
          Length = 6658

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL-VSNIIRQLCEALNDLH 32
            H   I ++      +  +++++++   +LFE +  +G +  +  V N +RQ+CE +  +H
Sbjct: 5768 HQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGYVMTEAEVINYMRQICEGIRHMH 5827

Query: 31   KHNFIHNDIK 2
            + N IH DIK
Sbjct: 5828 EQNIIHLDIK 5837


>AF023484-1|AAB81836.1|  684|Drosophila melanogaster putative KP78
           protein kinase protein.
          Length = 684

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ +L+N HPN ++++          +VM+Y    +LF+ L   G +  +    I RQ
Sbjct: 123 EVKIMKLLN-HPNIVRLFQVIESERTLYLVMEYASRGELFDHLVKNGRMRERDARVIFRQ 181

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+   H    +H D+K
Sbjct: 182 LVSAIQYCHSKFVVHRDLK 200


>AE014297-1284|AAF54627.1|  705|Drosophila melanogaster CG6715-PA
           protein.
          Length = 705

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 23/79 (29%), Positives = 40/79 (50%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+K+ +L+N HPN ++++          +VM+Y    +LF+ L   G +  +    I RQ
Sbjct: 145 EVKIMKLLN-HPNIVRLFQVIESERTLYLVMEYASRGELFDHLVKNGRMRERDARVIFRQ 203

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+   H    +H D+K
Sbjct: 204 LVSAIQYCHSKFVVHRDLK 222


>AE014135-137|AAS64601.1| 8647|Drosophila melanogaster CG32019-PE,
            isoform E protein.
          Length = 8647

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL-VSNIIRQLCEALNDLH 32
            H   I ++      +  +++++++   +LFE +  +G +  +  V N +RQ+CE +  +H
Sbjct: 7757 HQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGYVMTEAEVINYMRQICEGIRHMH 7816

Query: 31   KHNFIHNDIK 2
            + N IH DIK
Sbjct: 7817 EQNIIHLDIK 7826


>AE014135-136|AAS64600.1| 8648|Drosophila melanogaster CG32019-PC,
            isoform C protein.
          Length = 8648

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL-VSNIIRQLCEALNDLH 32
            H   I ++      +  +++++++   +LFE +  +G +  +  V N +RQ+CE +  +H
Sbjct: 7758 HQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGYVMTEAEVINYMRQICEGIRHMH 7817

Query: 31   KHNFIHNDIK 2
            + N IH DIK
Sbjct: 7818 EQNIIHLDIK 7827


>AE014135-135|AAS64599.1| 8930|Drosophila melanogaster CG32019-PD,
            isoform D protein.
          Length = 8930

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL-VSNIIRQLCEALNDLH 32
            H   I ++      +  +++++++   +LFE +  +G +  +  V N +RQ+CE +  +H
Sbjct: 8040 HQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGYVMTEAEVINYMRQICEGIRHMH 8099

Query: 31   KHNFIHNDIK 2
            + N IH DIK
Sbjct: 8100 EQNIIHLDIK 8109


>AE014135-134|AAF59316.4| 8943|Drosophila melanogaster CG32019-PA,
            isoform A protein.
          Length = 8943

 Score = 44.0 bits (99), Expect = 2e-04
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208  HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL-VSNIIRQLCEALNDLH 32
            H   I ++      +  +++++++   +LFE +  +G +  +  V N +RQ+CE +  +H
Sbjct: 8053 HQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGYVMTEAEVINYMRQICEGIRHMH 8112

Query: 31   KHNFIHNDIK 2
            + N IH DIK
Sbjct: 8113 EQNIIHLDIK 8122


>U29608-1|AAA70336.1| 1099|Drosophila melanogaster LATS protein.
          Length = 1099

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++    +N   VMDYI   DL   L   G    +L    I ++  A++ +HK  FI
Sbjct: 775 VKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFI 834

Query: 16  HNDIK 2
           H DIK
Sbjct: 835 HRDIK 839


>M74583-1|AAA51459.1|  490|Drosophila melanogaster
           calmodulin-dependent protein kinaseprotein.
          Length = 490

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    N   +V D +   +LFE +  +   S    S+ I+Q+ E++N  H+
Sbjct: 70  HPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQ 129

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 130 NGVVHRDLK 138


>L39837-1|AAA73959.1| 1099|Drosophila melanogaster tumor suppressor
           protein.
          Length = 1099

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++    +N   VMDYI   DL   L   G    +L    I ++  A++ +HK  FI
Sbjct: 775 VKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFI 834

Query: 16  HNDIK 2
           H DIK
Sbjct: 835 HRDIK 839


>BT029114-1|ABJ17047.1|  379|Drosophila melanogaster IP15240p
           protein.
          Length = 379

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    N   +V D +   +LFE +  +   S    S+ I+Q+ E++N  H+
Sbjct: 70  HPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQ 129

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 130 NGVVHRDLK 138


>BT010033-1|AAQ22502.1| 1180|Drosophila melanogaster LP05937p
           protein.
          Length = 1180

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I IY         V+VM++    +L++ L  +  L+ +    I RQ+  A+   HK
Sbjct: 127 HPNIIHIYEVFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHK 186

Query: 28  HNFIHNDIK 2
           H   H D+K
Sbjct: 187 HKICHRDLK 195


>AY095088-1|AAM11416.1|  748|Drosophila melanogaster RE56868p
           protein.
          Length = 748

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E++V + +N HP+ I +  +     N  +V++Y+   DLF+ +      S      +IR 
Sbjct: 523 EVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRH 581

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+  LH    +H DIK
Sbjct: 582 LGAAMTYLHSMGIVHRDIK 600


>AE014297-4663|AAF57085.1| 1105|Drosophila melanogaster CG12072-PA
           protein.
          Length = 1105

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           +K+Y++    +N   VMDYI   DL   L   G    +L    I ++  A++ +HK  FI
Sbjct: 781 VKLYYSFQDKDNLYFVMDYIPGGDLMSLLIKLGIFEEELARFYIAEVTCAVDSVHKMGFI 840

Query: 16  HNDIK 2
           H DIK
Sbjct: 841 HRDIK 845


>AE014297-1132|AAS65135.1| 1180|Drosophila melanogaster CG11870-PD,
           isoform D protein.
          Length = 1180

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I IY         V+VM++    +L++ L  +  L+ +    I RQ+  A+   HK
Sbjct: 127 HPNIIHIYEVFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHK 186

Query: 28  HNFIHNDIK 2
           H   H D+K
Sbjct: 187 HKICHRDLK 195


>AE014297-1131|AAS65134.1| 1427|Drosophila melanogaster CG11870-PC,
           isoform C protein.
          Length = 1427

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I IY         V+VM++    +L++ L  +  L+ +    I RQ+  A+   HK
Sbjct: 127 HPNIIHIYEVFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHK 186

Query: 28  HNFIHNDIK 2
           H   H D+K
Sbjct: 187 HKICHRDLK 195


>AE014297-1130|AAF54517.3| 1427|Drosophila melanogaster CG11870-PB,
           isoform B protein.
          Length = 1427

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I IY         V+VM++    +L++ L  +  L+ +    I RQ+  A+   HK
Sbjct: 127 HPNIIHIYEVFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHK 186

Query: 28  HNFIHNDIK 2
           H   H D+K
Sbjct: 187 HKICHRDLK 195


>AE014297-1129|AAF54516.3| 1427|Drosophila melanogaster CG11870-PA,
           isoform A protein.
          Length = 1427

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 22/69 (31%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN I IY         V+VM++    +L++ L  +  L+ +    I RQ+  A+   HK
Sbjct: 127 HPNIIHIYEVFENREKMVLVMEFAAGGELYDYLSERKVLTEEEARRIFRQVATAVYYCHK 186

Query: 28  HNFIHNDIK 2
           H   H D+K
Sbjct: 187 HKICHRDLK 195


>AE014135-177|AAN06568.2|  530|Drosophila melanogaster CG18069-PD,
           isoform D protein.
          Length = 530

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    N   +V D +   +LFE +  +   S    S+ I+Q+ E++N  H+
Sbjct: 70  HPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQ 129

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 130 NGVVHRDLK 138


>AE014135-176|AAX53595.1|  516|Drosophila melanogaster CG18069-PG,
           isoform G protein.
          Length = 516

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    N   +V D +   +LFE +  +   S    S+ I+Q+ E++N  H+
Sbjct: 70  HPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQ 129

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 130 NGVVHRDLK 138


>AE014135-175|AAN06569.2|  509|Drosophila melanogaster CG18069-PE,
           isoform E protein.
          Length = 509

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    N   +V D +   +LFE +  +   S    S+ I+Q+ E++N  H+
Sbjct: 70  HPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQ 129

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 130 NGVVHRDLK 138


>AE014135-174|AAF59390.2|  509|Drosophila melanogaster CG18069-PB,
           isoform B protein.
          Length = 509

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    N   +V D +   +LFE +  +   S    S+ I+Q+ E++N  H+
Sbjct: 70  HPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQ 129

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 130 NGVVHRDLK 138


>AE014135-173|AAF59389.3|  490|Drosophila melanogaster CG18069-PC,
           isoform C protein.
          Length = 490

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    N   +V D +   +LFE +  +   S    S+ I+Q+ E++N  H+
Sbjct: 70  HPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQ 129

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 130 NGVVHRDLK 138


>AE014135-172|AAF59388.3|  490|Drosophila melanogaster CG18069-PA,
           isoform A protein.
          Length = 490

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 19/69 (27%), Positives = 38/69 (55%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++ +    N   +V D +   +LFE +  +   S    S+ I+Q+ E++N  H+
Sbjct: 70  HPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVNHCHQ 129

Query: 28  HNFIHNDIK 2
           +  +H D+K
Sbjct: 130 NGVVHRDLK 138


>AE013599-38|EAA45999.1|  421|Drosophila melanogaster CG17528-PB,
           isoform B protein.
          Length = 421

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E++V + +N HP+ I +  +     N  +V++Y+   DLF+ +      S      +IR 
Sbjct: 196 EVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRH 254

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+  LH    +H DIK
Sbjct: 255 LGAAMTYLHSMGIVHRDIK 273


>AE013599-37|EAA45998.1|  421|Drosophila melanogaster CG17528-PA,
           isoform A protein.
          Length = 421

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E++V + +N HP+ I +  +     N  +V++Y+   DLF+ +      S      +IR 
Sbjct: 196 EVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRH 254

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+  LH    +H DIK
Sbjct: 255 LGAAMTYLHSMGIVHRDIK 273


>AE013599-36|EAA46000.1|  748|Drosophila melanogaster CG17528-PD,
           isoform D protein.
          Length = 748

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E++V + +N HP+ I +  +     N  +V++Y+   DLF+ +      S      +IR 
Sbjct: 523 EVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRH 581

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+  LH    +H DIK
Sbjct: 582 LGAAMTYLHSMGIVHRDIK 600


>AE013599-35|EAA45997.1|  748|Drosophila melanogaster CG17528-PC,
           isoform C protein.
          Length = 748

 Score = 43.2 bits (97), Expect = 4e-04
 Identities = 23/79 (29%), Positives = 39/79 (49%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E++V + +N HP+ I +  +     N  +V++Y+   DLF+ +      S      +IR 
Sbjct: 523 EVRVMKKLN-HPHIISLILSVDQNTNMYLVLEYVSGGDLFDAITQVTRFSENQSRIMIRH 581

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+  LH    +H DIK
Sbjct: 582 LGAAMTYLHSMGIVHRDIK 600


>Z35103-1|CAA84486.1|  455|Drosophila melanogaster Ndr protein
           kinase protein.
          Length = 455

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DH   +K+Y++     N  ++M+++   D+   L  K  LS +     I +   A++ +H
Sbjct: 149 DHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIH 208

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 209 KLGFIHRDIK 218


>BT016074-1|AAV36959.1|  582|Drosophila melanogaster LP06206p
           protein.
          Length = 582

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      ++  ++M+Y+   +LF+ +   G+L         +Q+   ++  H+
Sbjct: 85  HPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHR 144

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 145 HMIVHRDLK 153


>BT011020-1|AAR30180.1|  833|Drosophila melanogaster RE47050p
           protein.
          Length = 833

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 300 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 358

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 359 IVSAVQYCHQKRIIHRDLK 377


>BT009940-1|AAQ22409.1| 1046|Drosophila melanogaster SD05712p
           protein.
          Length = 1046

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 528 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 586

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 587 IVSAVQYCHQKRIIHRDLK 605


>AY058265-1|AAL13494.1| 1075|Drosophila melanogaster GH01890p
           protein.
          Length = 1075

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 462 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 520

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 521 IVSAVQYCHQKRIIHRDLK 539


>AY051880-1|AAK93304.1|  459|Drosophila melanogaster LD37189p
           protein.
          Length = 459

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DH   +K+Y++     N  ++M+++   D+   L  K  LS +     I +   A++ +H
Sbjct: 149 DHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIH 208

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 209 KLGFIHRDIK 218


>AL023893-2|CAA19653.1|  582|Drosophila melanogaster
           EG:132E8.2,FBgn0023169;SNF1A protein.
          Length = 582

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      ++  ++M+Y+   +LF+ +   G+L         +Q+   ++  H+
Sbjct: 85  HPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHR 144

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 145 HMIVHRDLK 153


>AF387636-1|AAK82366.1| 1058|Drosophila melanogaster Ser/Thr protein
           kinase PAR-1beta protein.
          Length = 1058

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 528 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 586

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 587 IVSAVQYCHQKRIIHRDLK 605


>AF387635-1|AAK82365.1|  832|Drosophila melanogaster Ser/Thr protein
           kinase PAR-1alpha protein.
          Length = 832

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 300 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 358

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 359 IVSAVQYCHQKRIIHRDLK 377


>AF258462-1|AAF69801.1|  938|Drosophila melanogaster PAR-1 protein.
          Length = 938

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 300 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 358

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 359 IVSAVQYCHQKRIIHRDLK 377


>AF247814-1|AAF97511.1|  463|Drosophila melanogaster NDR kinase
           protein.
          Length = 463

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DH   +K+Y++     N  ++M+++   D+   L  K  LS +     I +   A++ +H
Sbjct: 149 DHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIH 208

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 209 KLGFIHRDIK 218


>AF239171-1|AAF67168.1|  455|Drosophila melanogaster NDR protein
           kinase short form protein.
          Length = 455

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DH   +K+Y++     N  ++M+++   D+   L  K  LS +     I +   A++ +H
Sbjct: 149 DHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIH 208

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 209 KLGFIHRDIK 218


>AF238490-1|AAF67167.1|  459|Drosophila melanogaster NDR protein
           kinase protein.
          Length = 459

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DH   +K+Y++     N  ++M+++   D+   L  K  LS +     I +   A++ +H
Sbjct: 149 DHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIH 208

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 209 KLGFIHRDIK 218


>AF020310-1|AAB71398.1|  582|Drosophila melanogaster
           SNF1A/AMP-activated protein kinase protein.
          Length = 582

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      ++  ++M+Y+   +LF+ +   G+L         +Q+   ++  H+
Sbjct: 85  HPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHR 144

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 145 HMIVHRDLK 153


>AF020309-1|AAB71397.1|  582|Drosophila melanogaster
           SNF1A/AMP-activated protein kinase protein.
          Length = 582

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      ++  ++M+Y+   +LF+ +   G+L         +Q+   ++  H+
Sbjct: 85  HPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHR 144

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 145 HMIVHRDLK 153


>AE014298-193|AAS65245.1|  582|Drosophila melanogaster CG3051-PC,
           isoform C protein.
          Length = 582

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      ++  ++M+Y+   +LF+ +   G+L         +Q+   ++  H+
Sbjct: 85  HPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHR 144

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 145 HMIVHRDLK 153


>AE014298-192|AAN09043.1|  582|Drosophila melanogaster CG3051-PB,
           isoform B protein.
          Length = 582

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      ++  ++M+Y+   +LF+ +   G+L         +Q+   ++  H+
Sbjct: 85  HPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHR 144

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 145 HMIVHRDLK 153


>AE014298-191|AAF45614.1|  582|Drosophila melanogaster CG3051-PA,
           isoform A protein.
          Length = 582

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 17/69 (24%), Positives = 36/69 (52%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      ++  ++M+Y+   +LF+ +   G+L         +Q+   ++  H+
Sbjct: 85  HPHIIKLYQVISTPSDIFMIMEYVSGGELFDYIVKHGKLQEHQARRFFQQIISGVDYCHR 144

Query: 28  HNFIHNDIK 2
           H  +H D+K
Sbjct: 145 HMIVHRDLK 153


>AE014296-3228|AAF49104.1|  459|Drosophila melanogaster CG8637-PA
           protein.
          Length = 459

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 21/70 (30%), Positives = 36/70 (51%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           DH   +K+Y++     N  ++M+++   D+   L  K  LS +     I +   A++ +H
Sbjct: 149 DHQWVVKMYYSFQDPVNLYLIMEFLPGGDMMTLLMKKDTLSEEGTQFYISETALAIDSIH 208

Query: 31  KHNFIHNDIK 2
           K  FIH DIK
Sbjct: 209 KLGFIHRDIK 218


>AE013599-2911|AAM68417.1| 1033|Drosophila melanogaster CG8201-PE,
           isoform E protein.
          Length = 1033

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 528 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 586

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 587 IVSAVQYCHQKRIIHRDLK 605


>AE013599-2910|AAX52693.1| 1060|Drosophila melanogaster CG8201-PM,
           isoform M protein.
          Length = 1060

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 528 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 586

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 587 IVSAVQYCHQKRIIHRDLK 605


>AE013599-2909|AAF57548.2| 1060|Drosophila melanogaster CG8201-PD,
           isoform D protein.
          Length = 1060

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 528 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 586

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 587 IVSAVQYCHQKRIIHRDLK 605


>AE013599-2908|AAF57550.2| 1060|Drosophila melanogaster CG8201-PC,
           isoform C protein.
          Length = 1060

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 528 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 586

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 587 IVSAVQYCHQKRIIHRDLK 605


>AE013599-2907|AAF57549.2| 1098|Drosophila melanogaster CG8201-PF,
           isoform F protein.
          Length = 1098

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 528 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 586

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 587 IVSAVQYCHQKRIIHRDLK 605


>AE013599-2906|AAS64804.1| 1138|Drosophila melanogaster CG8201-PG,
           isoform G protein.
          Length = 1138

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 528 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 586

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 587 IVSAVQYCHQKRIIHRDLK 605


>AE013599-2904|AAS64803.1|  993|Drosophila melanogaster CG8201-PO,
           isoform O protein.
          Length = 993

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 423 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 481

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 482 IVSAVQYCHQKRIIHRDLK 500


>AE013599-2903|AAS64802.1|  993|Drosophila melanogaster CG8201-PJ,
           isoform J protein.
          Length = 993

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 423 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 481

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 482 IVSAVQYCHQKRIIHRDLK 500


>AE013599-2902|AAS64801.1|  993|Drosophila melanogaster CG8201-PI,
           isoform I protein.
          Length = 993

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 423 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 481

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 482 IVSAVQYCHQKRIIHRDLK 500


>AE013599-2901|AAS64800.1|  993|Drosophila melanogaster CG8201-PH,
           isoform H protein.
          Length = 993

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 423 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 481

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 482 IVSAVQYCHQKRIIHRDLK 500


>AE013599-2900|AAX52691.1|  833|Drosophila melanogaster CG8201-PN,
           isoform N protein.
          Length = 833

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 300 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 358

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 359 IVSAVQYCHQKRIIHRDLK 377


>AE013599-2899|AAX52690.1|  833|Drosophila melanogaster CG8201-PL,
           isoform L protein.
          Length = 833

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 300 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 358

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 359 IVSAVQYCHQKRIIHRDLK 377


>AE013599-2898|AAS64799.1|  905|Drosophila melanogaster CG8201-PB,
           isoform B protein.
          Length = 905

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 300 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 358

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 359 IVSAVQYCHQKRIIHRDLK 377


>AE013599-2897|AAS64798.1|  938|Drosophila melanogaster CG8201-PA,
           isoform A protein.
          Length = 938

 Score = 42.3 bits (95), Expect = 8e-04
 Identities = 19/79 (24%), Positives = 41/79 (51%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+++ +++ DHPN +K++          ++M+Y    ++F+ L + G +  +      RQ
Sbjct: 300 EVRIMKML-DHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQ 358

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +  A+   H+   IH D+K
Sbjct: 359 IVSAVQYCHQKRIIHRDLK 377


>AY113251-1|AAM29256.1|  411|Drosophila melanogaster AT13713p
           protein.
          Length = 411

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 22/79 (27%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E +V + +  HPN I++ +          V++++DC ++ + +Q +G LS     +++R 
Sbjct: 195 EAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLDC-NMQKVIQKRGILSEADARSVMRC 253

Query: 58  LCEALNDLHKHNFIHNDIK 2
              AL  +H+   IH DIK
Sbjct: 254 TVSALAHMHQLQVIHRDIK 272


>AE014297-3333|AAF56141.1|  411|Drosophila melanogaster CG10177-PA
           protein.
          Length = 411

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 22/79 (27%), Positives = 42/79 (53%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E +V + +  HPN I++ +          V++++DC ++ + +Q +G LS     +++R 
Sbjct: 195 EAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLDC-NMQKVIQKRGILSEADARSVMRC 253

Query: 58  LCEALNDLHKHNFIHNDIK 2
              AL  +H+   IH DIK
Sbjct: 254 TVSALAHMHQLQVIHRDIK 272


>AE014296-2593|AAF49569.3|  861|Drosophila melanogaster CG6114-PA
           protein.
          Length = 861

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 23/82 (28%), Positives = 45/82 (54%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFI---KIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           EI + +L+ DHP+ +    +Y N  ++    ++++++   +LF+ L  KG L+ +     
Sbjct: 65  EIAIMKLI-DHPHVLGLSDVYENKKYL---YLILEHVSGGELFDYLVKKGRLTPKEARKF 120

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
            RQ+  AL+  H H+  H D+K
Sbjct: 121 FRQIISALDFCHSHSICHRDLK 142


>AY118659-1|AAM50028.1| 1571|Drosophila melanogaster SD09178p protein.
          Length = 1571

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            +E+K+ + +  H N ++ Y         +I M+      L   +++ G L   L      
Sbjct: 1328 EELKILEGIK-HKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTA 1386

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            QL   +++LHKH  +H DIK
Sbjct: 1387 QLLSGVSELHKHGIVHRDIK 1406


>AY089322-1|AAL90060.1|  604|Drosophila melanogaster AT13327p
           protein.
          Length = 604

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 20/79 (25%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + +N HPN +++           +VM+Y+   +LF  L   G +  +    + RQ
Sbjct: 110 EVNIMKKLN-HPNIVRLLQVIESERTLYLVMEYVSGGELFNYLVKNGRMRERDARVLFRQ 168

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+   H  + +H D+K
Sbjct: 169 LVSAIEYCHSKSIVHRDLK 187


>AF023484-2|AAB81837.1|  604|Drosophila melanogaster putative KP78
           protein kinase protein.
          Length = 604

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 20/79 (25%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + +N HPN +++           +VM+Y+   +LF  L   G +  +    + RQ
Sbjct: 110 EVNIMKKLN-HPNIVRLLQVIESERTLYLVMEYVSGGELFNYLVKNGRMRERDARVLFRQ 168

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+   H  + +H D+K
Sbjct: 169 LVSAIEYCHSKSIVHRDLK 187


>AE014297-2578|AAF55592.1| 1612|Drosophila melanogaster CG7717-PA,
            isoform A protein.
          Length = 1612

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            +E+K+ + +  H N ++ Y         +I M+      L   +++ G L   L      
Sbjct: 1369 EELKILEGIK-HKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTA 1427

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            QL   +++LHKH  +H DIK
Sbjct: 1428 QLLSGVSELHKHGIVHRDIK 1447


>AE014297-2577|AAN13787.1| 1571|Drosophila melanogaster CG7717-PB,
            isoform B protein.
          Length = 1571

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            +E+K+ + +  H N ++ Y         +I M+      L   +++ G L   L      
Sbjct: 1328 EELKILEGIK-HKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTA 1386

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            QL   +++LHKH  +H DIK
Sbjct: 1387 QLLSGVSELHKHGIVHRDIK 1406


>AE014297-1283|AAF54626.1|  604|Drosophila melanogaster CG17216-PA
           protein.
          Length = 604

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 20/79 (25%), Positives = 38/79 (48%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E+ + + +N HPN +++           +VM+Y+   +LF  L   G +  +    + RQ
Sbjct: 110 EVNIMKKLN-HPNIVRLLQVIESERTLYLVMEYVSGGELFNYLVKNGRMRERDARVLFRQ 168

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L  A+   H  + +H D+K
Sbjct: 169 LVSAIEYCHSKSIVHRDLK 187


>AB069962-1|BAB62892.1| 1497|Drosophila melanogaster mekk1b protein.
          Length = 1497

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            +E+K+ + +  H N ++ Y         +I M+      L   +++ G L   L      
Sbjct: 1254 EELKILEGIK-HKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTA 1312

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            QL   +++LHKH  +H DIK
Sbjct: 1313 QLLSGVSELHKHGIVHRDIK 1332


>AB069961-1|BAB62891.1| 1571|Drosophila melanogaster mekk1a protein.
          Length = 1571

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 21/80 (26%), Positives = 37/80 (46%)
 Frame = -3

Query: 241  DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIR 62
            +E+K+ + +  H N ++ Y         +I M+      L   +++ G L   L      
Sbjct: 1328 EELKILEGIK-HKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTA 1386

Query: 61   QLCEALNDLHKHNFIHNDIK 2
            QL   +++LHKH  +H DIK
Sbjct: 1387 QLLSGVSELHKHGIVHRDIK 1406


>BT021340-1|AAX33488.1|  835|Drosophila melanogaster LP23904p
           protein.
          Length = 835

 Score = 38.3 bits (85), Expect = 0.012
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+Y +  DL + L +KG LS   V   + QL  A+  L+    +H D+K
Sbjct: 85  LVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGAMKALYTKGIVHRDLK 135


>BT001553-1|AAN71308.1|  284|Drosophila melanogaster RE12039p
           protein.
          Length = 284

 Score = 38.3 bits (85), Expect = 0.012
 Identities = 15/49 (30%), Positives = 31/49 (63%)
 Frame = -3

Query: 148 MDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           M+ +   +LF+ +  KG  + +  S++IRQ+ EA++ +H+   +H D+K
Sbjct: 1   MELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLK 49


>AY129445-1|AAM76187.1|  855|Drosophila melanogaster LD18893p
           protein.
          Length = 855

 Score = 38.3 bits (85), Expect = 0.012
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+Y +  DL + L +KG LS   V   + QL  A+  L+    +H D+K
Sbjct: 85  LVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGAMKALYTKGIVHRDLK 135


>AY069806-1|AAL39951.1| 1157|Drosophila melanogaster SD04681p protein.
          Length = 1157

 Score = 38.3 bits (85), Expect = 0.012
 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = -3

Query: 235  IKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KGELSHQLVSNIIRQ 59
            + +H+++ D  + ++   + G      +V +Y+D  DL   L+    + + +  ++I++Q
Sbjct: 864  VNLHEIVTDKQDAVEFRKDKGSF---YLVFEYMD-HDLMGLLESGMVDFNEENNASIMKQ 919

Query: 58   LCEALNDLHKHNFIHNDIK 2
            L + LN  HK NF+H DIK
Sbjct: 920  LLDGLNYCHKKNFLHRDIK 938


>AY060835-1|AAL28383.1|  422|Drosophila melanogaster GM01879p
           protein.
          Length = 422

 Score = 38.3 bits (85), Expect = 0.012
 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = -3

Query: 235 IKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KGELSHQLVSNIIRQ 59
           + +H+++ D  + ++   + G      +V +Y+D  DL   L+    + + +  ++I++Q
Sbjct: 129 VNLHEIVTDKQDAVEFRKDKGSF---YLVFEYMD-HDLMGLLESGMVDFNEENNASIMKQ 184

Query: 58  LCEALNDLHKHNFIHNDIK 2
           L + LN  HK NF+H DIK
Sbjct: 185 LLDGLNYCHKKNFLHRDIK 203


>AE014296-3555|AAN12171.1| 1157|Drosophila melanogaster CG7597-PB,
            isoform B protein.
          Length = 1157

 Score = 38.3 bits (85), Expect = 0.012
 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = -3

Query: 235  IKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KGELSHQLVSNIIRQ 59
            + +H+++ D  + ++   + G      +V +Y+D  DL   L+    + + +  ++I++Q
Sbjct: 864  VNLHEIVTDKQDAVEFRKDKGSF---YLVFEYMD-HDLMGLLESGMVDFNEENNASIMKQ 919

Query: 58   LCEALNDLHKHNFIHNDIK 2
            L + LN  HK NF+H DIK
Sbjct: 920  LLDGLNYCHKKNFLHRDIK 938


>AE014296-3554|AAF51738.1| 1157|Drosophila melanogaster CG7597-PA,
            isoform A protein.
          Length = 1157

 Score = 38.3 bits (85), Expect = 0.012
 Identities = 22/79 (27%), Positives = 44/79 (55%), Gaps = 1/79 (1%)
 Frame = -3

Query: 235  IKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KGELSHQLVSNIIRQ 59
            + +H+++ D  + ++   + G      +V +Y+D  DL   L+    + + +  ++I++Q
Sbjct: 864  VNLHEIVTDKQDAVEFRKDKGSF---YLVFEYMD-HDLMGLLESGMVDFNEENNASIMKQ 919

Query: 58   LCEALNDLHKHNFIHNDIK 2
            L + LN  HK NF+H DIK
Sbjct: 920  LLDGLNYCHKKNFLHRDIK 938


>AE014296-2189|AAF49878.1|  835|Drosophila melanogaster CG10967-PA
           protein.
          Length = 835

 Score = 38.3 bits (85), Expect = 0.012
 Identities = 18/51 (35%), Positives = 28/51 (54%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+Y +  DL + L +KG LS   V   + QL  A+  L+    +H D+K
Sbjct: 85  LVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGAMKALYTKGIVHRDLK 135


>AE014135-84|AAN06535.1|  284|Drosophila melanogaster CG1495-PH,
           isoform H protein.
          Length = 284

 Score = 38.3 bits (85), Expect = 0.012
 Identities = 15/49 (30%), Positives = 31/49 (63%)
 Frame = -3

Query: 148 MDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           M+ +   +LF+ +  KG  + +  S++IRQ+ EA++ +H+   +H D+K
Sbjct: 1   MELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLK 49


>AE014135-83|AAN06534.1|  284|Drosophila melanogaster CG1495-PD,
           isoform D protein.
          Length = 284

 Score = 38.3 bits (85), Expect = 0.012
 Identities = 15/49 (30%), Positives = 31/49 (63%)
 Frame = -3

Query: 148 MDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           M+ +   +LF+ +  KG  + +  S++IRQ+ EA++ +H+   +H D+K
Sbjct: 1   MELVTGGELFDRIVEKGSYTEKDASHLIRQILEAVDYMHEQGVVHRDLK 49


>AY052023-1|AAK93447.1|  639|Drosophila melanogaster LD47563p
           protein.
          Length = 639

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN ++ Y +   +N+++ +VM+Y++   L + +     +  + ++ + +Q  +AL  LH
Sbjct: 422 HPNIVETYSSF-LVNDELWVVMEYLEGGALTDIVT-HSRMDEEQIATVCKQCLKALAYLH 479

Query: 31  KHNFIHNDIK 2
               IH DIK
Sbjct: 480 SQGVIHRDIK 489


>AJ011578-1|CAA09699.1|  639|Drosophila melanogaster p21 activated
           kinase related proteinprotein.
          Length = 639

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN ++ Y +   +N+++ +VM+Y++   L + +     +  + ++ + +Q  +AL  LH
Sbjct: 422 HPNIVETYSSF-LVNDELWVVMEYLEGGALTDIVT-HSRMDEEQIATVCKQCLKALAYLH 479

Query: 31  KHNFIHNDIK 2
               IH DIK
Sbjct: 480 SQGVIHRDIK 489


>AF031517-1|AAD01935.1|  639|Drosophila melanogaster Ste20
           serine/threonine proteinkinase homolog protein.
          Length = 639

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN ++ Y +   +N+++ +VM+Y++   L + +     +  + ++ + +Q  +AL  LH
Sbjct: 422 HPNIVETYSSF-LVNDELWVVMEYLEGGALTDIVT-HSRMDEEQIATVCKQCLKALAYLH 479

Query: 31  KHNFIHNDIK 2
               IH DIK
Sbjct: 480 SQGVIHRDIK 489


>AE014298-2430|AAF48629.2|  639|Drosophila melanogaster CG18582-PA
           protein.
          Length = 639

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN ++ Y +   +N+++ +VM+Y++   L + +     +  + ++ + +Q  +AL  LH
Sbjct: 422 HPNIVETYSSF-LVNDELWVVMEYLEGGALTDIVT-HSRMDEEQIATVCKQCLKALAYLH 479

Query: 31  KHNFIHNDIK 2
               IH DIK
Sbjct: 480 SQGVIHRDIK 489


>AE014297-3638|AAF56344.1|  841|Drosophila melanogaster CG10951-PA
           protein.
          Length = 841

 Score = 37.9 bits (84), Expect = 0.016
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 9/104 (8%)
 Frame = -3

Query: 286 QIVFAENNF------GANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPD 125
           QIVF + N       G +  ++E+ V   ++ HPN +    +    N  +I M+Y D   
Sbjct: 130 QIVFKQINLSELSPPGRDLAMNEVDVFSKLH-HPNIVSYLGSFIKDNTLLIEMEYADGGT 188

Query: 124 LFETL---QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           L + +   Q K     + +  +  Q+  A+N +H  N +H D+K
Sbjct: 189 LAQIIAERQGKLHFPERYIIAVFEQISSAINYMHSENILHRDLK 232


>BT025098-1|ABE73269.1|  670|Drosophila melanogaster IP12358p
           protein.
          Length = 670

 Score = 37.1 bits (82), Expect = 0.028
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = -3

Query: 223 QLMND--HPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIRQLC 53
           ++MN   H   I++Y  + +     +V++ I+  +LF+  +  +  L+ ++    IRQ+C
Sbjct: 26  EIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVC 85

Query: 52  EALNDLHKHNFIHNDIK 2
           EA+  +H +  +H D+K
Sbjct: 86  EAMAFIHGNGIVHLDLK 102


>AY060726-1|AAL28274.1|  446|Drosophila melanogaster GH17420p
           protein.
          Length = 446

 Score = 37.1 bits (82), Expect = 0.028
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = -3

Query: 223 QLMND--HPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIRQLC 53
           ++MN   H   I++Y  + +     +V++ I+  +LF+  +  +  L+ ++    IRQ+C
Sbjct: 81  EIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVC 140

Query: 52  EALNDLHKHNFIHNDIK 2
           EA+  +H +  +H D+K
Sbjct: 141 EAMAFIHGNGIVHLDLK 157


>AE014296-2154|AAF49907.2| 1854|Drosophila melanogaster CG10522-PA
           protein.
          Length = 1854

 Score = 37.1 bits (82), Expect = 0.028
 Identities = 17/55 (30%), Positives = 28/55 (50%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +N  +VM+Y+   DL   +   G     L    + +L  AL+ LH+  ++H DIK
Sbjct: 180 DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIK 234


>AE013599-915|AAF58906.3|  446|Drosophila melanogaster CG1776-PA
           protein.
          Length = 446

 Score = 37.1 bits (82), Expect = 0.028
 Identities = 20/77 (25%), Positives = 43/77 (55%), Gaps = 3/77 (3%)
 Frame = -3

Query: 223 QLMND--HPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIRQLC 53
           ++MN   H   I++Y  + +     +V++ I+  +LF+  +  +  L+ ++    IRQ+C
Sbjct: 81  EIMNSLQHHLIIQLYAAYEYQKMMCVVLELIEGGELFDRVVDDEFVLTERVCRVFIRQVC 140

Query: 52  EALNDLHKHNFIHNDIK 2
           EA+  +H +  +H D+K
Sbjct: 141 EAMAFIHGNGIVHLDLK 157


>AY060800-1|AAL28348.1|  985|Drosophila melanogaster GH26463p
           protein.
          Length = 985

 Score = 36.7 bits (81), Expect = 0.038
 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 3/81 (3%)
 Frame = -3

Query: 235 IKVHQLMN-DHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           I++H L   +H N + +   F +     Q+++  +    DL+  ++ +  +  +L S I 
Sbjct: 628 IEIHLLQTLNHKNIVSVLDVFENDLFY-QLVMEKHGSGMDLWTFIERRPLMDEKLGSYIF 686

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ +A+N LH+   +H DIK
Sbjct: 687 RQVADAVNYLHEQKILHRDIK 707


>AE013599-3767|AAF47129.2|  985|Drosophila melanogaster CG3105-PA
           protein.
          Length = 985

 Score = 36.7 bits (81), Expect = 0.038
 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 3/81 (3%)
 Frame = -3

Query: 235 IKVHQLMN-DHPNFIKIY--FNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNII 65
           I++H L   +H N + +   F +     Q+++  +    DL+  ++ +  +  +L S I 
Sbjct: 628 IEIHLLQTLNHKNIVSVLDVFENDLFY-QLVMEKHGSGMDLWTFIERRPLMDEKLGSYIF 686

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ +A+N LH+   +H DIK
Sbjct: 687 RQVADAVNYLHEQKILHRDIK 707


>X83466-1|CAA58469.1|  421|Drosophila melanogaster aurora protein.
          Length = 421

 Score = 36.3 bits (80), Expect = 0.050
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY-FNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNI 68
           EI++   +  HP+ +++Y + H  +   +I ++Y     LF  LQ +       +  +  
Sbjct: 212 EIEIQSHLR-HPHILRLYAYFHDDVRIYLI-LEYAPQGTLFNALQAQPMKRFDERQSATY 269

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           I+ LC AL  LH+ + IH DIK
Sbjct: 270 IQALCSALLYLHERDIIHRDIK 291


>X83465-1|CAA58468.1|  421|Drosophila melanogaster aurora protein.
          Length = 421

 Score = 36.3 bits (80), Expect = 0.050
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY-FNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNI 68
           EI++   +  HP+ +++Y + H  +   +I ++Y     LF  LQ +       +  +  
Sbjct: 212 EIEIQSHLR-HPHILRLYAYFHDDVRIYLI-LEYAPQGTLFNALQAQPMKRFDERQSATY 269

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           I+ LC AL  LH+ + IH DIK
Sbjct: 270 IQALCSALLYLHERDIIHRDIK 291


>AY061229-1|AAL28777.1|  411|Drosophila melanogaster LD16949p
           protein.
          Length = 411

 Score = 36.3 bits (80), Expect = 0.050
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY-FNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNI 68
           EI++   +  HP+ +++Y + H  +   +I ++Y     LF  LQ +       +  +  
Sbjct: 202 EIEIQSHLR-HPHILRLYAYFHDDVRIYLI-LEYAPQGTLFNALQAQPMKRFDERQSATY 259

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           I+ LC AL  LH+ + IH DIK
Sbjct: 260 IQALCSALLYLHERDIIHRDIK 281


>AE014297-1411|AAF54723.1|  411|Drosophila melanogaster CG3068-PA
           protein.
          Length = 411

 Score = 36.3 bits (80), Expect = 0.050
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 3/82 (3%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIY-FNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNI 68
           EI++   +  HP+ +++Y + H  +   +I ++Y     LF  LQ +       +  +  
Sbjct: 202 EIEIQSHLR-HPHILRLYAYFHDDVRIYLI-LEYAPQGTLFNALQAQPMKRFDERQSATY 259

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           I+ LC AL  LH+ + IH DIK
Sbjct: 260 IQALCSALLYLHERDIIHRDIK 281


>U56080-1|AAB01209.1|  704|Drosophila melanogaster p21-activated
           protein kinase 1Dpak1 protein.
          Length = 704

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           ++EI V +  N HPN +  Y +   ++ ++ +VM+Y+    L + +  +  +    ++ +
Sbjct: 473 INEILVMR-ENKHPNVVN-YLDSYLVSEELWVVMEYLPGGSLTDVVT-ETCMDEGQIAGV 529

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
            R++ +AL  LH +  IH DIK
Sbjct: 530 CREVLQALEFLHANQVIHRDIK 551


>U20757-1|AAA86885.1|  359|Drosophila melanogaster MAP kinase
           activated protein kinase-2 protein.
          Length = 359

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 20/71 (28%), Positives = 41/71 (57%), Gaps = 4/71 (5%)
 Frame = -3

Query: 202 NFIKIYFNHGFINNQ--VIVMDYIDCPDLFETLQIK--GELSHQLVSNIIRQLCEALNDL 35
           N I +Y N  F + +  ++VM+ ++  +LF+ +Q K  G  + +  + I+ ++C A++ L
Sbjct: 75  NIIDVYENT-FKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYL 133

Query: 34  HKHNFIHNDIK 2
           H  +  H D+K
Sbjct: 134 HSRDIAHRDLK 144


>AY095014-1|AAM11342.1|  860|Drosophila melanogaster GH25405p
           protein.
          Length = 860

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIR 62
           E++  +L+  HPN +++Y          +V++  D  DL++  ++    LS +L     R
Sbjct: 67  EVRCMKLVQ-HPNVVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFR 125

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  A+   H+ + +H D+K
Sbjct: 126 QILRAITYCHQLHVVHRDLK 145


>AY069813-1|AAL39958.1|  201|Drosophila melanogaster SD05481p
           protein.
          Length = 201

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 20/71 (28%), Positives = 41/71 (57%), Gaps = 4/71 (5%)
 Frame = -3

Query: 202 NFIKIYFNHGFINNQ--VIVMDYIDCPDLFETLQIK--GELSHQLVSNIIRQLCEALNDL 35
           N I +Y N  F + +  ++VM+ ++  +LF+ +Q K  G  + +  + I+ ++C A++ L
Sbjct: 75  NIIDVYENT-FKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYL 133

Query: 34  HKHNFIHNDIK 2
           H  +  H D+K
Sbjct: 134 HSRDIAHRDLK 144


>AY060397-1|AAL25436.1|  317|Drosophila melanogaster LD31205p
           protein.
          Length = 317

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 7/78 (8%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQ-----VIVMDYI--DCPDLFETLQIKGELSHQLVSNIIRQL 56
           ++H N +K+Y    F+        ++V +++  D  DL + L   G +S   +  + R+L
Sbjct: 83  SNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSG-MSPPTIQRLSREL 141

Query: 55  CEALNDLHKHNFIHNDIK 2
              ++ LH H  IH D+K
Sbjct: 142 LTGVDFLHSHRIIHRDLK 159


>AY052073-1|AAK93497.1|  860|Drosophila melanogaster SD02969p
           protein.
          Length = 860

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIR 62
           E++  +L+  HPN +++Y          +V++  D  DL++  ++    LS +L     R
Sbjct: 67  EVRCMKLVQ-HPNVVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFR 125

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  A+   H+ + +H D+K
Sbjct: 126 QILRAITYCHQLHVVHRDLK 145


>AL031765-7|CAA21125.1| 1398|Drosophila melanogaster EG:22E5.8
           protein.
          Length = 1398

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 19/69 (27%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      N   IV +Y    ++F+ +   G +S         Q+  A+   HK
Sbjct: 197 HPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVEYCHK 256

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 257 KGIVHRDLK 265


>AE014298-792|AAF46078.3|  359|Drosophila melanogaster CG3086-PD,
           isoform D protein.
          Length = 359

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 20/71 (28%), Positives = 41/71 (57%), Gaps = 4/71 (5%)
 Frame = -3

Query: 202 NFIKIYFNHGFINNQ--VIVMDYIDCPDLFETLQIK--GELSHQLVSNIIRQLCEALNDL 35
           N I +Y N  F + +  ++VM+ ++  +LF+ +Q K  G  + +  + I+ ++C A++ L
Sbjct: 75  NIIDVYENT-FKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYL 133

Query: 34  HKHNFIHNDIK 2
           H  +  H D+K
Sbjct: 134 HSRDIAHRDLK 144


>AE014298-791|AAN09152.1|  359|Drosophila melanogaster CG3086-PC,
           isoform C protein.
          Length = 359

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 20/71 (28%), Positives = 41/71 (57%), Gaps = 4/71 (5%)
 Frame = -3

Query: 202 NFIKIYFNHGFINNQ--VIVMDYIDCPDLFETLQIK--GELSHQLVSNIIRQLCEALNDL 35
           N I +Y N  F + +  ++VM+ ++  +LF+ +Q K  G  + +  + I+ ++C A++ L
Sbjct: 75  NIIDVYENT-FKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYL 133

Query: 34  HKHNFIHNDIK 2
           H  +  H D+K
Sbjct: 134 HSRDIAHRDLK 144


>AE014298-790|AAG22408.1|  359|Drosophila melanogaster CG3086-PB,
           isoform B protein.
          Length = 359

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 20/71 (28%), Positives = 41/71 (57%), Gaps = 4/71 (5%)
 Frame = -3

Query: 202 NFIKIYFNHGFINNQ--VIVMDYIDCPDLFETLQIK--GELSHQLVSNIIRQLCEALNDL 35
           N I +Y N  F + +  ++VM+ ++  +LF+ +Q K  G  + +  + I+ ++C A++ L
Sbjct: 75  NIIDVYENT-FKDRKCLLVVMECMEGGELFQRIQDKADGAFTEREAAQIMHEICAAVDYL 133

Query: 34  HKHNFIHNDIK 2
           H  +  H D+K
Sbjct: 134 HSRDIAHRDLK 144


>AE014298-317|AAF45711.1| 1398|Drosophila melanogaster CG4290-PA
           protein.
          Length = 1398

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 19/69 (27%), Positives = 31/69 (44%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP+ IK+Y      N   IV +Y    ++F+ +   G +S         Q+  A+   HK
Sbjct: 197 HPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVEYCHK 256

Query: 28  HNFIHNDIK 2
              +H D+K
Sbjct: 257 KGIVHRDLK 265


>AE013599-2311|AAM68505.1|  317|Drosophila melanogaster CG5072-PC,
           isoform C protein.
          Length = 317

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 7/78 (8%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQ-----VIVMDYI--DCPDLFETLQIKGELSHQLVSNIIRQL 56
           ++H N +K+Y    F+        ++V +++  D  DL + L   G +S   +  + R+L
Sbjct: 83  SNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSG-MSPPTIQRLSREL 141

Query: 55  CEALNDLHKHNFIHNDIK 2
              ++ LH H  IH D+K
Sbjct: 142 LTGVDFLHSHRIIHRDLK 159


>AE013599-2310|AAF57981.1|  317|Drosophila melanogaster CG5072-PB,
           isoform B protein.
          Length = 317

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 7/78 (8%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQ-----VIVMDYI--DCPDLFETLQIKGELSHQLVSNIIRQL 56
           ++H N +K+Y    F+        ++V +++  D  DL + L   G +S   +  + R+L
Sbjct: 83  SNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSG-MSPPTIQRLSREL 141

Query: 55  CEALNDLHKHNFIHNDIK 2
              ++ LH H  IH D+K
Sbjct: 142 LTGVDFLHSHRIIHRDLK 159


>AE013599-2309|AAF57980.1|  317|Drosophila melanogaster CG5072-PA,
           isoform A protein.
          Length = 317

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 21/78 (26%), Positives = 39/78 (50%), Gaps = 7/78 (8%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFINNQ-----VIVMDYI--DCPDLFETLQIKGELSHQLVSNIIRQL 56
           ++H N +K+Y    F+        ++V +++  D  DL + L   G +S   +  + R+L
Sbjct: 83  SNHANIVKLYEVCQFLERDGQLLILLVFEHVEQDLSDLIDRLPKSG-MSPPTIQRLSREL 141

Query: 55  CEALNDLHKHNFIHNDIK 2
              ++ LH H  IH D+K
Sbjct: 142 LTGVDFLHSHRIIHRDLK 159


>AE013599-1854|AAM70996.1|  860|Drosophila melanogaster CG8485-PD,
           isoform D protein.
          Length = 860

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIR 62
           E++  +L+  HPN +++Y          +V++  D  DL++  ++    LS +L     R
Sbjct: 67  EVRCMKLVQ-HPNVVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFR 125

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  A+   H+ + +H D+K
Sbjct: 126 QILRAITYCHQLHVVHRDLK 145


>AE013599-1853|AAM70995.1|  860|Drosophila melanogaster CG8485-PC,
           isoform C protein.
          Length = 860

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIR 62
           E++  +L+  HPN +++Y          +V++  D  DL++  ++    LS +L     R
Sbjct: 67  EVRCMKLVQ-HPNVVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFR 125

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  A+   H+ + +H D+K
Sbjct: 126 QILRAITYCHQLHVVHRDLK 145


>AE013599-1852|AAM70994.1|  860|Drosophila melanogaster CG8485-PB,
           isoform B protein.
          Length = 860

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIR 62
           E++  +L+  HPN +++Y          +V++  D  DL++  ++    LS +L     R
Sbjct: 67  EVRCMKLVQ-HPNVVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFR 125

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  A+   H+ + +H D+K
Sbjct: 126 QILRAITYCHQLHVVHRDLK 145


>AE013599-1851|AAF58274.1|  860|Drosophila melanogaster CG8485-PA,
           isoform A protein.
          Length = 860

 Score = 35.9 bits (79), Expect = 0.066
 Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFE-TLQIKGELSHQLVSNIIR 62
           E++  +L+  HPN +++Y          +V++  D  DL++  ++    LS +L     R
Sbjct: 67  EVRCMKLVQ-HPNVVRLYEVIDTQTKLYLVLELGDGGDLYDYIMKHDSGLSEELARKYFR 125

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           Q+  A+   H+ + +H D+K
Sbjct: 126 QILRAITYCHQLHVVHRDLK 145


>BT010086-1|AAQ22555.1|  630|Drosophila melanogaster LD04521p
           protein.
          Length = 630

 Score = 35.5 bits (78), Expect = 0.087
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQ-IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+  DC DL + LQ     L    + NI+ Q+ +A+N +H+H  IH+D+K
Sbjct: 413 MVMEKGDC-DLNKILQSYTTNLPLYSLMNILYQMLQAVNYIHQHGVIHSDLK 463


>AJ577475-1|CAE12059.1| 1342|Drosophila melanogaster polo kinase
           kinase 1 protein.
          Length = 1342

 Score = 35.5 bits (78), Expect = 0.087
 Identities = 16/70 (22%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN +++Y      +   ++++Y D   L   + +++  L+   ++ + + + E L  LH
Sbjct: 91  HPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKPLTEPQIAYVCKHMTEGLTFLH 150

Query: 31  KHNFIHNDIK 2
           ++  IH D+K
Sbjct: 151 RNKVIHRDLK 160


>AE014297-2385|AAF55450.1|  630|Drosophila melanogaster CG7643-PA
           protein.
          Length = 630

 Score = 35.5 bits (78), Expect = 0.087
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQ-IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+  DC DL + LQ     L    + NI+ Q+ +A+N +H+H  IH+D+K
Sbjct: 413 MVMEKGDC-DLNKILQSYTTNLPLYSLMNILYQMLQAVNYIHQHGVIHSDLK 463


>AE013599-3861|AAM68311.1| 1300|Drosophila melanogaster CG4527-PA,
           isoform A protein.
          Length = 1300

 Score = 35.5 bits (78), Expect = 0.087
 Identities = 16/70 (22%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN +++Y      +   ++++Y D   L   + +++  L+   ++ + + + E L  LH
Sbjct: 91  HPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKPLTEPQIAYVCKHMTEGLTFLH 150

Query: 31  KHNFIHNDIK 2
           ++  IH D+K
Sbjct: 151 RNKVIHRDLK 160


>AE013599-3860|AAS64767.1| 1703|Drosophila melanogaster CG4527-PD,
           isoform D protein.
          Length = 1703

 Score = 35.5 bits (78), Expect = 0.087
 Identities = 16/70 (22%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN +++Y      +   ++++Y D   L   + +++  L+   ++ + + + E L  LH
Sbjct: 91  HPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKPLTEPQIAYVCKHMTEGLTFLH 150

Query: 31  KHNFIHNDIK 2
           ++  IH D+K
Sbjct: 151 RNKVIHRDLK 160


>AE013599-3859|AAS64766.1| 1703|Drosophila melanogaster CG4527-PC,
           isoform C protein.
          Length = 1703

 Score = 35.5 bits (78), Expect = 0.087
 Identities = 16/70 (22%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN +++Y      +   ++++Y D   L   + +++  L+   ++ + + + E L  LH
Sbjct: 91  HPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKPLTEPQIAYVCKHMTEGLTFLH 150

Query: 31  KHNFIHNDIK 2
           ++  IH D+K
Sbjct: 151 RNKVIHRDLK 160


>AE013599-3858|AAF47198.2| 1703|Drosophila melanogaster CG4527-PB,
           isoform B protein.
          Length = 1703

 Score = 35.5 bits (78), Expect = 0.087
 Identities = 16/70 (22%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN +++Y      +   ++++Y D   L   + +++  L+   ++ + + + E L  LH
Sbjct: 91  HPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKPLTEPQIAYVCKHMTEGLTFLH 150

Query: 31  KHNFIHNDIK 2
           ++  IH D+K
Sbjct: 151 RNKVIHRDLK 160


>AE013599-3857|AAX52684.1| 1342|Drosophila melanogaster CG4527-PE,
           isoform E protein.
          Length = 1342

 Score = 35.5 bits (78), Expect = 0.087
 Identities = 16/70 (22%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLH 32
           HPN +++Y      +   ++++Y D   L   + +++  L+   ++ + + + E L  LH
Sbjct: 91  HPNIVELYEAFSIDDKLWMLIEYCDGGALDSIMVELEKPLTEPQIAYVCKHMTEGLTFLH 150

Query: 31  KHNFIHNDIK 2
           ++  IH D+K
Sbjct: 151 RNKVIHRDLK 160


>X99510-1|CAA67860.1|  317|Drosophila melanogaster CDK4/6 kinase
           protein.
          Length = 317

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 21/78 (26%), Positives = 42/78 (53%), Gaps = 7/78 (8%)
 Frame = -3

Query: 214 NDHPNFIKIYFNHGFI--NNQVIVM---DYI--DCPDLFETLQIKGELSHQLVSNIIRQL 56
           ++H N +K+Y    F+  + Q++++   +++  D  DL + L   G +S   +  + R+L
Sbjct: 83  SNHANIVKLYEVCQFLERDGQLLILLAFEHVEQDLSDLIDRLPKSG-MSPPTIQRLSREL 141

Query: 55  CEALNDLHKHNFIHNDIK 2
              ++ LH H  IH D+K
Sbjct: 142 LTGVDFLHSHRIIHRDLK 159


>X63361-1|CAA44963.1|  576|Drosophila melanogaster protein kinase
           protein.
          Length = 576

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI +H+ +N HPN +K +       N  IV++      + E  + +  ++       I Q
Sbjct: 73  EITIHRSLN-HPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKSITEFECRYYIYQ 131

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + + +  LH +  IH D+K
Sbjct: 132 IIQGVKYLHDNRIIHRDLK 150


>U49446-1|AAC47094.1|  704|Drosophila melanogaster serine/threonine
           kinase PAK homologDPAK protein.
          Length = 704

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           ++EI V +  N HPN +  Y +   ++ ++ +VM+Y+    L + +  +  +    ++ +
Sbjct: 473 INEILVMR-ENKHPNVVN-YLDSYLVSEELWVVMEYLPGGSLTDVVT-ETCMDEGQIAAV 529

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
            R++ +AL  LH +  IH DIK
Sbjct: 530 CREVLQALEFLHANQVIHRDIK 551


>BT010291-1|AAQ23609.1|  704|Drosophila melanogaster LD20767p
           protein.
          Length = 704

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           ++EI V +  N HPN +  Y +   ++ ++ +VM+Y+    L + +  +  +    ++ +
Sbjct: 473 INEILVMR-ENKHPNVVN-YLDSYLVSEELWVVMEYLPGGSLTDVVT-ETCMDEGQIAAV 529

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
            R++ +AL  LH +  IH DIK
Sbjct: 530 CREVLQALEFLHANQVIHRDIK 551


>BT003294-1|AAO25054.1|  460|Drosophila melanogaster GH27460p
           protein.
          Length = 460

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 16/69 (23%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++     +    +V ++I   +L+  +   G L     + +++QL  A+  +H 
Sbjct: 14  HPNILRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHS 73

Query: 28  HNFIHNDIK 2
             ++H DIK
Sbjct: 74  LGYVHRDIK 82


>AY119163-1|AAM51023.1|  460|Drosophila melanogaster RH22541p
           protein.
          Length = 460

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 16/69 (23%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++     +    +V ++I   +L+  +   G L     + +++QL  A+  +H 
Sbjct: 14  HPNILRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHS 73

Query: 28  HNFIHNDIK 2
             ++H DIK
Sbjct: 74  LGYVHRDIK 82


>AY095028-1|AAM11356.1|  576|Drosophila melanogaster LD11851p
           protein.
          Length = 576

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI +H+ +N HPN +K +       N  IV++      + E  + +  ++       I Q
Sbjct: 73  EITIHRSLN-HPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKSITEFECRYYIYQ 131

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + + +  LH +  IH D+K
Sbjct: 132 IIQGVKYLHDNRIIHRDLK 150


>AY071688-1|AAL49310.1|  947|Drosophila melanogaster RH10407p
           protein.
          Length = 947

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 6/86 (6%)
 Frame = -3

Query: 241 DEIKVHQ----LMND--HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL 80
           D+I++ Q    +M D  HPN I  Y ++   +   I M++     L +  Q+ G L+   
Sbjct: 63  DDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQ 122

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++ + R+  + L  LH    +H DIK
Sbjct: 123 IAYMCRETLKGLEYLHSMGKMHRDIK 148


>AE014297-447|AAN13373.1|  704|Drosophila melanogaster CG10295-PC,
           isoform C protein.
          Length = 704

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           ++EI V +  N HPN +  Y +   ++ ++ +VM+Y+    L + +  +  +    ++ +
Sbjct: 473 INEILVMR-ENKHPNVVN-YLDSYLVSEELWVVMEYLPGGSLTDVVT-ETCMDEGQIAAV 529

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
            R++ +AL  LH +  IH DIK
Sbjct: 530 CREVLQALEFLHANQVIHRDIK 551


>AE014297-446|AAF54132.1|  704|Drosophila melanogaster CG10295-PB,
           isoform B protein.
          Length = 704

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           ++EI V +  N HPN +  Y +   ++ ++ +VM+Y+    L + +  +  +    ++ +
Sbjct: 473 INEILVMR-ENKHPNVVN-YLDSYLVSEELWVVMEYLPGGSLTDVVT-ETCMDEGQIAAV 529

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
            R++ +AL  LH +  IH DIK
Sbjct: 530 CREVLQALEFLHANQVIHRDIK 551


>AE014297-445|AAF54131.1|  704|Drosophila melanogaster CG10295-PA,
           isoform A protein.
          Length = 704

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 22/82 (26%), Positives = 45/82 (54%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQV-IVMDYIDCPDLFETLQIKGELSHQLVSNI 68
           ++EI V +  N HPN +  Y +   ++ ++ +VM+Y+    L + +  +  +    ++ +
Sbjct: 473 INEILVMR-ENKHPNVVN-YLDSYLVSEELWVVMEYLPGGSLTDVVT-ETCMDEGQIAAV 529

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
            R++ +AL  LH +  IH DIK
Sbjct: 530 CREVLQALEFLHANQVIHRDIK 551


>AE014296-3322|AAX52738.1|  576|Drosophila melanogaster CG12306-PB,
           isoform B protein.
          Length = 576

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI +H+ +N HPN +K +       N  IV++      + E  + +  ++       I Q
Sbjct: 73  EITIHRSLN-HPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKSITEFECRYYIYQ 131

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + + +  LH +  IH D+K
Sbjct: 132 IIQGVKYLHDNRIIHRDLK 150


>AE014296-3321|AAF49036.1|  576|Drosophila melanogaster CG12306-PA,
           isoform A protein.
          Length = 576

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 20/79 (25%), Positives = 37/79 (46%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           EI +H+ +N HPN +K +       N  IV++      + E  + +  ++       I Q
Sbjct: 73  EITIHRSLN-HPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKSITEFECRYYIYQ 131

Query: 58  LCEALNDLHKHNFIHNDIK 2
           + + +  LH +  IH D+K
Sbjct: 132 IIQGVKYLHDNRIIHRDLK 150


>AE014134-197|AAS64629.1|  460|Drosophila melanogaster CG4629-PC,
           isoform C protein.
          Length = 460

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 16/69 (23%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++     +    +V ++I   +L+  +   G L     + +++QL  A+  +H 
Sbjct: 14  HPNILRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHS 73

Query: 28  HNFIHNDIK 2
             ++H DIK
Sbjct: 74  LGYVHRDIK 82


>AE014134-196|AAN10479.2|  534|Drosophila melanogaster CG4629-PB,
           isoform B protein.
          Length = 534

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 16/69 (23%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++     +    +V ++I   +L+  +   G L     + +++QL  A+  +H 
Sbjct: 88  HPNILRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHS 147

Query: 28  HNFIHNDIK 2
             ++H DIK
Sbjct: 148 LGYVHRDIK 156


>AE014134-195|AAF51422.3|  534|Drosophila melanogaster CG4629-PA,
           isoform A protein.
          Length = 534

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 16/69 (23%), Positives = 35/69 (50%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HPN ++++     +    +V ++I   +L+  +   G L     + +++QL  A+  +H 
Sbjct: 88  HPNILRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHS 147

Query: 28  HNFIHNDIK 2
             ++H DIK
Sbjct: 148 LGYVHRDIK 156


>AE013599-2836|AAM70845.1|  947|Drosophila melanogaster CG7097-PB,
           isoform B protein.
          Length = 947

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 6/86 (6%)
 Frame = -3

Query: 241 DEIKVHQ----LMND--HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL 80
           D+I++ Q    +M D  HPN I  Y ++   +   I M++     L +  Q+ G L+   
Sbjct: 63  DDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQ 122

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++ + R+  + L  LH    +H DIK
Sbjct: 123 IAYMCRETLKGLEYLHSMGKMHRDIK 148


>AE013599-2835|AAF57595.1| 1218|Drosophila melanogaster CG7097-PA,
           isoform A protein.
          Length = 1218

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 24/86 (27%), Positives = 42/86 (48%), Gaps = 6/86 (6%)
 Frame = -3

Query: 241 DEIKVHQ----LMND--HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQL 80
           D+I++ Q    +M D  HPN I  Y ++   +   I M++     L +  Q+ G L+   
Sbjct: 63  DDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIYQVTGPLTEVQ 122

Query: 79  VSNIIRQLCEALNDLHKHNFIHNDIK 2
           ++ + R+  + L  LH    +H DIK
Sbjct: 123 IAYMCRETLKGLEYLHSMGKMHRDIK 148


>X57486-1|CAA40724.1|  314|Drosophila melanogaster p34-cdc2
           homologue protein.
          Length = 314

 Score = 34.7 bits (76), Expect = 0.15
 Identities = 17/70 (24%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL-SHQLVSNIIRQLCEALNDLH 32
           HPN ++++      NN  ++ +Y++  DL + +  K ++ + QL+ + + Q+ +A+   H
Sbjct: 64  HPNVVQLFDVVISGNNLYMIFEYLNM-DLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCH 122

Query: 31  KHNFIHNDIK 2
            +  +H D+K
Sbjct: 123 TNRILHRDLK 132


>BT021275-1|AAX33423.1|  671|Drosophila melanogaster RE44754p
           protein.
          Length = 671

 Score = 34.7 bits (76), Expect = 0.15
 Identities = 21/79 (26%), Positives = 34/79 (43%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E KV  L   HP    ++      ++   VM+Y++  DL   +Q  G  S +       +
Sbjct: 391 ERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAE 450

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   L  LHK   I+ D+K
Sbjct: 451 IISGLKFLHKKGIIYRDLK 469


>AY051671-1|AAK93095.1|  314|Drosophila melanogaster LD22351p
           protein.
          Length = 314

 Score = 34.7 bits (76), Expect = 0.15
 Identities = 17/70 (24%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL-SHQLVSNIIRQLCEALNDLH 32
           HPN ++++      NN  ++ +Y++  DL + +  K ++ + QL+ + + Q+ +A+   H
Sbjct: 64  HPNVVQLFDVVISGNNLYMIFEYLNM-DLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCH 122

Query: 31  KHNFIHNDIK 2
            +  +H D+K
Sbjct: 123 TNRILHRDLK 132


>AE014298-1764|AAF48160.3|  671|Drosophila melanogaster CG10524-PA
           protein.
          Length = 671

 Score = 34.7 bits (76), Expect = 0.15
 Identities = 21/79 (26%), Positives = 34/79 (43%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQ 59
           E KV  L   HP    ++      ++   VM+Y++  DL   +Q  G  S +       +
Sbjct: 391 ERKVLALGTKHPYLCHLFCTFQTESHLFFVMEYLNGGDLMFHIQESGRFSEERARFYGAE 450

Query: 58  LCEALNDLHKHNFIHNDIK 2
           +   L  LHK   I+ D+K
Sbjct: 451 IISGLKFLHKKGIIYRDLK 469


>AE014297-2847|AAF55799.1|  314|Drosophila melanogaster CG10498-PB,
           isoform B protein.
          Length = 314

 Score = 34.7 bits (76), Expect = 0.15
 Identities = 17/70 (24%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL-SHQLVSNIIRQLCEALNDLH 32
           HPN ++++      NN  ++ +Y++  DL + +  K ++ + QL+ + + Q+ +A+   H
Sbjct: 64  HPNVVQLFDVVISGNNLYMIFEYLNM-DLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCH 122

Query: 31  KHNFIHNDIK 2
            +  +H D+K
Sbjct: 123 TNRILHRDLK 132


>AE014297-2846|AAN14363.1|  314|Drosophila melanogaster CG10498-PA,
           isoform A protein.
          Length = 314

 Score = 34.7 bits (76), Expect = 0.15
 Identities = 17/70 (24%), Positives = 40/70 (57%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL-SHQLVSNIIRQLCEALNDLH 32
           HPN ++++      NN  ++ +Y++  DL + +  K ++ + QL+ + + Q+ +A+   H
Sbjct: 64  HPNVVQLFDVVISGNNLYMIFEYLNM-DLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCH 122

Query: 31  KHNFIHNDIK 2
            +  +H D+K
Sbjct: 123 TNRILHRDLK 132


>D89663-1|BAA20906.1|  832|Drosophila melanogaster myosin light
           chain kinase isoform-II protein.
          Length = 832

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
           ++EI + + +  HP  +++  +       V+VM+YI   +LFE +      L+       
Sbjct: 422 LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILF 480

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +RQ+C+ +  +H  + +H D+K
Sbjct: 481 LRQVCDGVAYMHGQSVVHLDLK 502


>D89661-1|BAA19488.1|  929|Drosophila melanogaster myosin light
           chain kinase  isoform-I protein.
          Length = 929

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
           ++EI + + +  HP  +++  +       V+VM+YI   +LFE +      L+       
Sbjct: 338 LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILF 396

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +RQ+C+ +  +H  + +H D+K
Sbjct: 397 LRQVCDGVAYMHGQSVVHLDLK 418


>BT004846-1|AAO45202.1|  769|Drosophila melanogaster RE70136p
           protein.
          Length = 769

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ-IKGELSHQLVSNIIR 62
           E+++H  +  HP+ +++Y      N   +V++     +L   +  I    +    ++I++
Sbjct: 62  EVEIHSRLK-HPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHIARPFTETEAASILK 120

Query: 61  QLCEALNDLHKHNFIHNDI 5
           Q+   L  LH HN +H DI
Sbjct: 121 QVVAGLLYLHSHNIMHRDI 139


>AY058648-1|AAL13877.1|  846|Drosophila melanogaster LD35132p
           protein.
          Length = 846

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 16/65 (24%), Positives = 32/65 (49%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           + ++++   ++   +VM+Y+   DL   L + G          + ++  AL  LH+H  +
Sbjct: 119 VSLFYSLQSLSYVYLVMEYMVGGDLKSLLAMFGYFDEPTARFYVAEMVMALQYLHQHGIV 178

Query: 16  HNDIK 2
           H DIK
Sbjct: 179 HRDIK 183


>AF255671-1|AAG01798.1|  732|Drosophila melanogaster Stretchin-MLCK
           protein.
          Length = 732

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
           ++EI + + +  HP  +++  +       V+VM+YI   +LFE +      L+       
Sbjct: 194 LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILF 252

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +RQ+C+ +  +H  + +H D+K
Sbjct: 253 LRQVCDGVAYMHGQSVVHLDLK 274


>AF255670-1|AAG01797.1|  786|Drosophila melanogaster Stretchin-MLCK
           protein.
          Length = 786

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
           ++EI + + +  HP  +++  +       V+VM+YI   +LFE +      L+       
Sbjct: 195 LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILF 253

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +RQ+C+ +  +H  + +H D+K
Sbjct: 254 LRQVCDGVAYMHGQSVVHLDLK 275


>AF255669-1|AAG01796.1|  623|Drosophila melanogaster Stretchin-MLCK
           protein.
          Length = 623

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
           ++EI + + +  HP  +++  +       V+VM+YI   +LFE +      L+       
Sbjct: 32  LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILF 90

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +RQ+C+ +  +H  + +H D+K
Sbjct: 91  LRQVCDGVAYMHGQSVVHLDLK 112


>AF255668-1|AAG01795.1|  577|Drosophila melanogaster Stretchin-MLCK
           protein.
          Length = 577

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
           ++EI + + +  HP  +++  +       V+VM+YI   +LFE +      L+       
Sbjct: 297 LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILF 355

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +RQ+C+ +  +H  + +H D+K
Sbjct: 356 LRQVCDGVAYMHGQSVVHLDLK 377


>AF106952-1|AAD19607.1|  769|Drosophila melanogaster
           serine/threonine kinase protein.
          Length = 769

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ-IKGELSHQLVSNIIR 62
           E+++H  +  HP+ +++Y      N   +V++     +L   +  I    +    ++I++
Sbjct: 62  EVEIHSRLK-HPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHIARPFTETEAASILK 120

Query: 61  QLCEALNDLHKHNFIHNDI 5
           Q+   L  LH HN +H DI
Sbjct: 121 QVVAGLLYLHSHNIMHRDI 139


>AE014297-2580|AAF55594.2|  846|Drosophila melanogaster CG7719-PA
           protein.
          Length = 846

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 16/65 (24%), Positives = 32/65 (49%)
 Frame = -3

Query: 196 IKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFI 17
           + ++++   ++   +VM+Y+   DL   L + G          + ++  AL  LH+H  +
Sbjct: 119 VSLFYSLQSLSYVYLVMEYMVGGDLKSLLAMFGYFDEPTARFYVAEMVMALQYLHQHGIV 178

Query: 16  HNDIK 2
           H DIK
Sbjct: 179 HRDIK 183


>AE014296-3553|AAF51737.1|  769|Drosophila melanogaster CG7186-PA
           protein.
          Length = 769

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ-IKGELSHQLVSNIIR 62
           E+++H  +  HP+ +++Y      N   +V++     +L   +  I    +    ++I++
Sbjct: 62  EVEIHSRLK-HPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHIARPFTETEAASILK 120

Query: 61  QLCEALNDLHKHNFIHNDI 5
           Q+   L  LH HN +H DI
Sbjct: 121 QVVAGLLYLHSHNIMHRDI 139


>AE013599-2145|AAM70938.1|  785|Drosophila melanogaster CG18255-PG,
           isoform G protein.
          Length = 785

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
           ++EI + + +  HP  +++  +       V+VM+YI   +LFE +      L+       
Sbjct: 194 LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILF 252

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +RQ+C+ +  +H  + +H D+K
Sbjct: 253 LRQVCDGVAYMHGQSVVHLDLK 274


>AE013599-2144|AAF58089.2|  929|Drosophila melanogaster CG18255-PB,
           isoform B protein.
          Length = 929

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
           ++EI + + +  HP  +++  +       V+VM+YI   +LFE +      L+       
Sbjct: 338 LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILF 396

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +RQ+C+ +  +H  + +H D+K
Sbjct: 397 LRQVCDGVAYMHGQSVVHLDLK 418


>AE013599-2143|AAF58090.2| 1506|Drosophila melanogaster CG18255-PF,
            isoform F protein.
          Length = 1506

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244  VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
            ++EI + + +  HP  +++  +       V+VM+YI   +LFE +      L+       
Sbjct: 915  LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILF 973

Query: 67   IRQLCEALNDLHKHNFIHNDIK 2
            +RQ+C+ +  +H  + +H D+K
Sbjct: 974  LRQVCDGVAYMHGQSVVHLDLK 995


>AE013599-2142|AAM70937.1| 4463|Drosophila melanogaster CG18255-PC,
            isoform C protein.
          Length = 4463

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244  VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
            ++EI + + +  HP  +++  +       V+VM+YI   +LFE +      L+       
Sbjct: 3872 LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILF 3930

Query: 67   IRQLCEALNDLHKHNFIHNDIK 2
            +RQ+C+ +  +H  + +H D+K
Sbjct: 3931 LRQVCDGVAYMHGQSVVHLDLK 3952


>AE013599-2141|AAM70936.1| 9270|Drosophila melanogaster CG18255-PA,
            isoform A protein.
          Length = 9270

 Score = 34.3 bits (75), Expect = 0.20
 Identities = 20/82 (24%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244  VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
            ++EI + + +  HP  +++  +       V+VM+YI   +LFE +      L+       
Sbjct: 8679 LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELFERVVADDFTLTEMDCILF 8737

Query: 67   IRQLCEALNDLHKHNFIHNDIK 2
            +RQ+C+ +  +H  + +H D+K
Sbjct: 8738 LRQVCDGVAYMHGQSVVHLDLK 8759


>U13014-1|AAA64560.1|  560|Drosophila melanogaster phosphorylase
           kinase gamma protein.
          Length = 560

 Score = 33.9 bits (74), Expect = 0.26
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP--DLFETLQIKGELSHQLVSNII 65
           EI + + +  HP  I +     F ++  + + +  CP  +LF+ L     LS +    I+
Sbjct: 77  EISILRQVMGHPYIIDL--QDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIM 134

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ E +  +H  + +H D+K
Sbjct: 135 RQIFEGVEYIHAKSIVHRDLK 155


>AY051698-1|AAK93122.1| 1637|Drosophila melanogaster LD24220p
           protein.
          Length = 1637

 Score = 33.9 bits (74), Expect = 0.26
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = -3

Query: 163 NQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N  +VMDY    DL   L + + +L   +    I ++  A+N +H+  ++H DIK
Sbjct: 172 NLYLVMDYYCGGDLLTLLSKFEDKLPEDMAKFYITEMILAINSIHQIRYVHRDIK 226


>AY051635-1|AAK93059.1|  419|Drosophila melanogaster GH28523p
           protein.
          Length = 419

 Score = 33.9 bits (74), Expect = 0.26
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP--DLFETLQIKGELSHQLVSNII 65
           EI + + +  HP  I +     F ++  + + +  CP  +LF+ L     LS +    I+
Sbjct: 77  EISILRQVMGHPYIIDL--QDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIM 134

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ E +  +H  + +H D+K
Sbjct: 135 RQIFEGVEYIHAKSIVHRDLK 155


>AY051575-1|AAK92999.1|  560|Drosophila melanogaster GH22314p
           protein.
          Length = 560

 Score = 33.9 bits (74), Expect = 0.26
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP--DLFETLQIKGELSHQLVSNII 65
           EI + + +  HP  I +     F ++  + + +  CP  +LF+ L     LS +    I+
Sbjct: 77  EISILRQVMGHPYIIDL--QDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIM 134

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ E +  +H  + +H D+K
Sbjct: 135 RQIFEGVEYIHAKSIVHRDLK 155


>AF029395-1|AAB96643.1| 1613|Drosophila melanogaster Genghis Khan
           protein.
          Length = 1613

 Score = 33.9 bits (74), Expect = 0.26
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = -3

Query: 163 NQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N  +VMDY    DL   L + + +L   +    I ++  A+N +H+  ++H DIK
Sbjct: 148 NLYLVMDYYCGGDLLTLLSKFEDKLPEDMAKFYITEMILAINSIHQIRYVHRDIK 202


>AE014298-1665|AAF48077.2|  502|Drosophila melanogaster CG1830-PC,
           isoform C protein.
          Length = 502

 Score = 33.9 bits (74), Expect = 0.26
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP--DLFETLQIKGELSHQLVSNII 65
           EI + + +  HP  I +     F ++  + + +  CP  +LF+ L     LS +    I+
Sbjct: 77  EISILRQVMGHPYIIDL--QDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIM 134

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ E +  +H  + +H D+K
Sbjct: 135 RQIFEGVEYIHAKSIVHRDLK 155


>AE014298-1664|AAG22343.2|  502|Drosophila melanogaster CG1830-PA,
           isoform A protein.
          Length = 502

 Score = 33.9 bits (74), Expect = 0.26
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP--DLFETLQIKGELSHQLVSNII 65
           EI + + +  HP  I +     F ++  + + +  CP  +LF+ L     LS +    I+
Sbjct: 77  EISILRQVMGHPYIIDL--QDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIM 134

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ E +  +H  + +H D+K
Sbjct: 135 RQIFEGVEYIHAKSIVHRDLK 155


>AE014298-1663|AAN09640.1|  419|Drosophila melanogaster CG1830-PB,
           isoform B protein.
          Length = 419

 Score = 33.9 bits (74), Expect = 0.26
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 2/81 (2%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCP--DLFETLQIKGELSHQLVSNII 65
           EI + + +  HP  I +     F ++  + + +  CP  +LF+ L     LS +    I+
Sbjct: 77  EISILRQVMGHPYIIDL--QDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIM 134

Query: 64  RQLCEALNDLHKHNFIHNDIK 2
           RQ+ E +  +H  + +H D+K
Sbjct: 135 RQIFEGVEYIHAKSIVHRDLK 155


>AE013599-3814|AAF47163.1| 1637|Drosophila melanogaster CG4012-PA
           protein.
          Length = 1637

 Score = 33.9 bits (74), Expect = 0.26
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%)
 Frame = -3

Query: 163 NQVIVMDYIDCPDLFETL-QIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           N  +VMDY    DL   L + + +L   +    I ++  A+N +H+  ++H DIK
Sbjct: 172 NLYLVMDYYCGGDLLTLLSKFEDKLPEDMAKFYITEMILAINSIHQIRYVHRDIK 226


>X16961-1|CAA34835.1|  502|Drosophila melanogaster protein (
           Drosophila melanogastermRNA for put. protein kinase DC2.
           ).
          Length = 502

 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  I + ++    +N  ++ DY+   +LF  L+  G+ + Q  +    ++  AL  LH 
Sbjct: 250 HPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHS 309

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 310 LQIVYRDLK 318


>AY118681-1|AAM50541.1|  585|Drosophila melanogaster AT10577p
           protein.
          Length = 585

 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  I + ++    +N  ++ DY+   +LF  L+  G+ + Q  +    ++  AL  LH 
Sbjct: 333 HPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHS 392

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 393 LQIVYRDLK 401


>AE014296-2595|AAF49568.2|  500|Drosophila melanogaster CG6117-PA,
           isoform A protein.
          Length = 500

 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  I + ++    +N  ++ DY+   +LF  L+  G+ + Q  +    ++  AL  LH 
Sbjct: 248 HPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHS 307

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 308 LQIVYRDLK 316


>AE014296-2594|AAN11771.2|  583|Drosophila melanogaster CG6117-PB,
           isoform B protein.
          Length = 583

 Score = 33.1 bits (72), Expect = 0.46
 Identities = 17/69 (24%), Positives = 34/69 (49%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  I + ++    +N  ++ DY+   +LF  L+  G+ + Q  +    ++  AL  LH 
Sbjct: 331 HPFVISLEWSTKDDSNLYMIFDYVCGGELFTYLRNAGKFTSQTSNFYAAEIVSALEYLHS 390

Query: 28  HNFIHNDIK 2
              ++ D+K
Sbjct: 391 LQIVYRDLK 399


>AF142061-1|AAD48407.1| 1207|Drosophila melanogaster protein kinase
           JIL-1 protein.
          Length = 1207

 Score = 32.7 bits (71), Expect = 0.61
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQV---IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALN 41
           D  N   I   HG    +    IVM+Y+  P+L  ++++  +   +    I  QL  A+ 
Sbjct: 673 DTTNHKNIVSYHGTFREKCETWIVMEYLSGPELTASIRMDEDSCRE----IFLQLVMAVR 728

Query: 40  DLHKHNFIHNDIK 2
            +H  +FIH D+K
Sbjct: 729 HIHSKHFIHGDLK 741



 Score = 29.5 bits (63), Expect = 5.7
 Identities = 20/95 (21%), Positives = 39/95 (41%)
 Frame = -3

Query: 286 QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ 107
           +I   +    A     E  V + +  +P  + +++     +   +V+D+ +  +LF  L 
Sbjct: 297 KITVVQKRKTAEHTKTERVVLEAIQRNPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLY 356

Query: 106 IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
                    V   I ++  AL  LH+   I+ DIK
Sbjct: 357 HSENFEESRVRVYIAEVVLALEQLHQLGIIYRDIK 391


>AE014296-1893|AAF50105.1| 1207|Drosophila melanogaster CG6297-PB,
           isoform B protein.
          Length = 1207

 Score = 32.7 bits (71), Expect = 0.61
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQV---IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALN 41
           D  N   I   HG    +    IVM+Y+  P+L  ++++  +   +    I  QL  A+ 
Sbjct: 673 DTTNHKNIVSYHGTFREKCETWIVMEYLSGPELTASIRMDEDSCRE----IFLQLVMAVR 728

Query: 40  DLHKHNFIHNDIK 2
            +H  +FIH D+K
Sbjct: 729 HIHSKHFIHGDLK 741



 Score = 29.5 bits (63), Expect = 5.7
 Identities = 20/95 (21%), Positives = 39/95 (41%)
 Frame = -3

Query: 286 QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ 107
           +I   +    A     E  V + +  +P  + +++     +   +V+D+ +  +LF  L 
Sbjct: 297 KITVVQKRKTAEHTKTERVVLEAIQRNPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLY 356

Query: 106 IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
                    V   I ++  AL  LH+   I+ DIK
Sbjct: 357 HSENFEESRVRVYIAEVVLALEQLHQLGIIYRDIK 391


>AE014296-1892|AAN11898.1| 1207|Drosophila melanogaster CG6297-PA,
           isoform A protein.
          Length = 1207

 Score = 32.7 bits (71), Expect = 0.61
 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 3/73 (4%)
 Frame = -3

Query: 211 DHPNFIKIYFNHGFINNQV---IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALN 41
           D  N   I   HG    +    IVM+Y+  P+L  ++++  +   +    I  QL  A+ 
Sbjct: 673 DTTNHKNIVSYHGTFREKCETWIVMEYLSGPELTASIRMDEDSCRE----IFLQLVMAVR 728

Query: 40  DLHKHNFIHNDIK 2
            +H  +FIH D+K
Sbjct: 729 HIHSKHFIHGDLK 741



 Score = 29.5 bits (63), Expect = 5.7
 Identities = 20/95 (21%), Positives = 39/95 (41%)
 Frame = -3

Query: 286 QIVFAENNFGANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQ 107
           +I   +    A     E  V + +  +P  + +++     +   +V+D+ +  +LF  L 
Sbjct: 297 KITVVQKRKTAEHTKTERVVLEAIQRNPFLVSLHYAFQSSSKLYLVLDFANGGELFTHLY 356

Query: 106 IKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
                    V   I ++  AL  LH+   I+ DIK
Sbjct: 357 HSENFEESRVRVYIAEVVLALEQLHQLGIIYRDIK 391


>X94264-1|CAA63940.1|  571|Drosophila melanogaster calcium
           /calmodulin dependentprotein kinase protein.
          Length = 571

 Score = 32.3 bits (70), Expect = 0.81
 Identities = 18/76 (23%), Positives = 43/76 (56%), Gaps = 4/76 (5%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDL-FETLQ--IKGELSHQLVS-NIIRQLCE 50
           M  HP+ +++   +       +V ++++  DL FE ++  + G +  + V+ + +RQ+ E
Sbjct: 68  MLKHPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILE 127

Query: 49  ALNDLHKHNFIHNDIK 2
           AL   H+++ +H D++
Sbjct: 128 ALRYCHENDILHRDVR 143


>AE014297-3042|AAF55922.2|  898|Drosophila melanogaster CG6703-PB,
           isoform B protein.
          Length = 898

 Score = 32.3 bits (70), Expect = 0.81
 Identities = 18/76 (23%), Positives = 43/76 (56%), Gaps = 4/76 (5%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDL-FETLQ--IKGELSHQLVS-NIIRQLCE 50
           M  HP+ +++   +       +V ++++  DL FE ++  + G +  + V+ + +RQ+ E
Sbjct: 68  MLKHPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILE 127

Query: 49  ALNDLHKHNFIHNDIK 2
           AL   H+++ +H D++
Sbjct: 128 ALRYCHENDILHRDVR 143


>U53190-1|AAC80169.1|  897|Drosophila melanogaster Camguk protein.
          Length = 897

 Score = 31.9 bits (69), Expect = 1.1
 Identities = 18/76 (23%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = -3

Query: 217 MNDHPNFIKIYFNHGFINNQVIVMDYIDCPDL-FETLQ--IKGELSHQLVS-NIIRQLCE 50
           M  HP+ +++   +       +V ++++  DL FE ++  + G +  + V+ + +RQ+ E
Sbjct: 68  MLKHPHIVELLETYSSEGMLYMVFEFMEGSDLCFEVVRRAVAGFVYSEAVACHYMRQILE 127

Query: 49  ALNDLHKHNFIHNDIK 2
           AL   H++  +H D++
Sbjct: 128 ALRYCHENEILHRDVR 143


>U67304-1|AAC47429.1|  637|Drosophila melanogaster 70 kDa S6 kinase
           protein.
          Length = 637

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 15/69 (21%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +++ +         ++++Y+   +LF  L+ +G          + ++  AL  LHK
Sbjct: 138 HPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIIFALGHLHK 197

Query: 28  HNFIHNDIK 2
              I+ D+K
Sbjct: 198 LGIIYRDLK 206


>U66562-1|AAC47312.4|  490|Drosophila melanogaster p70s6k protein
           kinase homolog protein.
          Length = 490

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 15/69 (21%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +++ +         ++++Y+   +LF  L+ +G          + ++  AL  LHK
Sbjct: 138 HPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHK 197

Query: 28  HNFIHNDIK 2
              I+ D+K
Sbjct: 198 LGIIYRDLK 206


>BT011183-1|AAR88544.1|  603|Drosophila melanogaster RE17878p
           protein.
          Length = 603

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 3/83 (3%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGEL---SHQLVS 74
           ++E KV   +  HPN +++Y          IV +Y+    L   L+  G+    +  L+ 
Sbjct: 384 IEEAKVMTKLQ-HPNLVQLYGVCSKHRPIYIVTEYMKHGSLLNYLRRHGKTLIGNMGLLL 442

Query: 73  NIIRQLCEALNDLHKHNFIHNDI 5
           ++  Q+ + +  L +HN+IH D+
Sbjct: 443 DMCIQVSKGMTYLERHNYIHRDL 465


>AY095090-1|AAM11418.1|  247|Drosophila melanogaster RE65159p
           protein.
          Length = 247

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 15/69 (21%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +++ +         ++++Y+   +LF  L+ +G          + ++  AL  LHK
Sbjct: 138 HPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHK 197

Query: 28  HNFIHNDIK 2
              I+ D+K
Sbjct: 198 LGIIYRDLK 206


>AY075222-1|AAL68089.1|  390|Drosophila melanogaster AT17410p
           protein.
          Length = 390

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KGELSHQLVSNIIR 62
           E KV++ +   P F  +       N   +VMD +  P L E   + K   S + V  +  
Sbjct: 70  EAKVYEQLARCPGFPTLLHYGCEKNYNAMVMDLLG-PSLEELFNLCKRRFSLKTVLMLTD 128

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           QL   +  +H+  FIH DIK
Sbjct: 129 QLLMRIECVHERGFIHRDIK 148


>AE014296-2536|AAF49616.1| 2139|Drosophila melanogaster CG6498-PA
            protein.
          Length = 2139

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 16/70 (22%), Positives = 32/70 (45%)
 Frame = -3

Query: 211  DHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLH 32
            D+P  + +Y +     +  +VM+Y++  D    L+  G L   +      +   A+  LH
Sbjct: 891  DNPFVVSMYCSFETKKHLCLVMEYVEGGDCGTLLKNIGPLPADMARFYFAETVLAVEYLH 950

Query: 31   KHNFIHNDIK 2
             +  +H D+K
Sbjct: 951  SYGIVHRDLK 960


>AE014296-1014|AAF50742.1|  490|Drosophila melanogaster CG10539-PA
           protein.
          Length = 490

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 15/69 (21%), Positives = 32/69 (46%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHK 29
           HP  +++ +         ++++Y+   +LF  L+ +G          + ++  AL  LHK
Sbjct: 138 HPFIVELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHK 197

Query: 28  HNFIHNDIK 2
              I+ D+K
Sbjct: 198 LGIIYRDLK 206


>AE014134-2867|AAF53630.2|  390|Drosophila melanogaster CG7094-PA
           protein.
          Length = 390

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 1/80 (1%)
 Frame = -3

Query: 238 EIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQI-KGELSHQLVSNIIR 62
           E KV++ +   P F  +       N   +VMD +  P L E   + K   S + V  +  
Sbjct: 70  EAKVYEQLARCPGFPTLLHYGCEKNYNAMVMDLLG-PSLEELFNLCKRRFSLKTVLMLTD 128

Query: 61  QLCEALNDLHKHNFIHNDIK 2
           QL   +  +H+  FIH DIK
Sbjct: 129 QLLMRIECVHERGFIHRDIK 148


>AE014134-1728|AAF52832.2|  659|Drosophila melanogaster CG31711-PA
           protein.
          Length = 659

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 20/83 (24%), Positives = 43/83 (51%), Gaps = 1/83 (1%)
 Frame = -3

Query: 247 NVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSN 71
           N+ E+K  + ++ HPN +K+       +    V +Y+   +L++ ++ +   L    + +
Sbjct: 47  NLREVKSLKKLS-HPNIVKLKEVIRENDTLYFVFEYMK-ENLYQMIKDRDTHLPEPELKS 104

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
           I+ Q+   L  +H+H F H D+K
Sbjct: 105 ILFQVLTGLAFMHRHGFFHRDLK 127


>AY118312-1|AAM48341.1|  836|Drosophila melanogaster GH26429p
           protein.
          Length = 836

 Score = 31.1 bits (67), Expect = 1.9
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -3

Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +G LS ++   +I Q+  AL  LH  N +H D+K
Sbjct: 635 RGRLSERVTKFLITQILIALKYLHSQNIVHCDLK 668


>AE014297-2501|AAN13770.3|  836|Drosophila melanogaster CG7125-PD,
           isoform D protein.
          Length = 836

 Score = 31.1 bits (67), Expect = 1.9
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -3

Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +G LS ++   +I Q+  AL  LH  N +H D+K
Sbjct: 635 RGRLSERVTKFLITQILIALKYLHSQNIVHCDLK 668


>AE014297-2500|AAF55537.4|  836|Drosophila melanogaster CG7125-PC,
           isoform C protein.
          Length = 836

 Score = 31.1 bits (67), Expect = 1.9
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -3

Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +G LS ++   +I Q+  AL  LH  N +H D+K
Sbjct: 635 RGRLSERVTKFLITQILIALKYLHSQNIVHCDLK 668


>AE014297-2499|AAN13769.3|  836|Drosophila melanogaster CG7125-PB,
           isoform B protein.
          Length = 836

 Score = 31.1 bits (67), Expect = 1.9
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -3

Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +G LS ++   +I Q+  AL  LH  N +H D+K
Sbjct: 635 RGRLSERVTKFLITQILIALKYLHSQNIVHCDLK 668


>AE014297-2498|AAF55536.4|  836|Drosophila melanogaster CG7125-PA,
           isoform A protein.
          Length = 836

 Score = 31.1 bits (67), Expect = 1.9
 Identities = 13/34 (38%), Positives = 20/34 (58%)
 Frame = -3

Query: 103 KGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +G LS ++   +I Q+  AL  LH  N +H D+K
Sbjct: 635 RGRLSERVTKFLITQILIALKYLHSQNIVHCDLK 668


>D89662-1|BAA19489.1|  569|Drosophila melanogaster myosin light
           chain kinase  isoform-III protein.
          Length = 569

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 18/82 (21%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG-ELSHQLVSNI 68
           ++EI + + +  HP  +++  +       V+VM+YI   +L + +      L+       
Sbjct: 289 LEEISIMRALQ-HPKLLQLAASFESPREIVMVMEYITGGELLQRVVADDFTLTEMDCILF 347

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +RQ+C+ +  +H  + +H D+K
Sbjct: 348 LRQVCDGVAYMHGQSVVHLDLK 369


>AE014297-3225|AAF56055.2|  258|Drosophila melanogaster CG4803-PA
           protein.
          Length = 258

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 26/114 (22%), Positives = 47/114 (41%), Gaps = 6/114 (5%)
 Frame = -3

Query: 325 FWQNIYFIAQAH*QIVFAENNFGANFNVDEIKVHQLMN-DHPNFIKIYFNHGFINNQVIV 149
           F+ ++Y     + +I       G      E +++QL    H N +++Y         +++
Sbjct: 23  FYGSVYRAVWRNREIALKRIREGCEDKKIEREIYQLTKASHVNIVELYGTSRHEGCALLL 82

Query: 148 MDYIDCPDLFETLQIKGE--LSHQLVSNIIRQLCEALNDLH---KHNFIHNDIK 2
           M+++D   L   L  K +   SH    N   Q+ + +  LH       IH DIK
Sbjct: 83  MEFVDGGSLSSFLHAKSKPSYSHAHAFNWAHQIAQGIAYLHGMQPKAVIHRDIK 136


>AE014296-475|AAS64945.1| 1102|Drosophila melanogaster CG16973-PD,
           isoform D protein.
          Length = 1102

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQ-IKGE-LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+Y     + + ++  KG+ L  + ++ I R++   L+ LH +  IH DIK
Sbjct: 110 LVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIK 162


>AE014296-474|AAS64944.1| 1102|Drosophila melanogaster CG16973-PC,
           isoform C protein.
          Length = 1102

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQ-IKGE-LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+Y     + + ++  KG+ L  + ++ I R++   L+ LH +  IH DIK
Sbjct: 110 LVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIK 162


>AE014296-473|AAS64943.1| 1042|Drosophila melanogaster CG16973-PE,
           isoform E protein.
          Length = 1042

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQ-IKGE-LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+Y     + + ++  KG+ L  + ++ I R++   L+ LH +  IH DIK
Sbjct: 110 LVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIK 162


>AE014296-472|AAF47658.3| 1504|Drosophila melanogaster CG16973-PA,
           isoform A protein.
          Length = 1504

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQ-IKGE-LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+Y     + + ++  KG+ L  + ++ I R++   L+ LH +  IH DIK
Sbjct: 110 LVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIK 162


>AE014296-471|AAS64942.1| 1200|Drosophila melanogaster CG16973-PB,
           isoform B protein.
          Length = 1200

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQ-IKGE-LSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+Y     + + ++  KG+ L  + ++ I R++   L+ LH +  IH DIK
Sbjct: 110 LVMEYCGAGSVTDLVKSTKGQSLKEEWIAYICREILRGLSYLHSNKVIHRDIK 162


>AY118401-1|AAM48430.1|  828|Drosophila melanogaster RE60792p
           protein.
          Length = 828

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = -3

Query: 202 NFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNIIRQLCEALNDLHK 29
           N I ++    F N+  I  + +   +L+E ++  G    S QLV      L + L+ L+K
Sbjct: 337 NIIHMFDYFTFRNHTCITFELLSI-NLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYK 395

Query: 28  HNFIHNDIK 2
           ++ IH D+K
Sbjct: 396 NDIIHCDMK 404


>AY095005-1|AAM11333.1|  695|Drosophila melanogaster GH08190p
           protein.
          Length = 695

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = -3

Query: 79  VSNIIRQLCEALNDLH-KHNFIHNDIK 2
           V NIIRQ+ E L+ LH K + IH DIK
Sbjct: 456 VRNIIRQVLEGLDYLHSKCSIIHTDIK 482


>AY094630-1|AAM10983.1|  749|Drosophila melanogaster AT02150p
           protein.
          Length = 749

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = -3

Query: 79  VSNIIRQLCEALNDLH-KHNFIHNDIK 2
           V NIIRQ+ E L+ LH K + IH DIK
Sbjct: 389 VRNIIRQVLEGLDYLHSKCSIIHTDIK 415


>AF005239-1|AAC23709.1|  460|Drosophila melanogaster DEAD-box
           helicase protein.
          Length = 460

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 12/35 (34%), Positives = 21/35 (60%)
 Frame = -1

Query: 411 RHKCTLQTLVQFYENCKNVKTRYKIINGRFGKISI 307
           R + +L+ + Q+Y  CKN + +Y  I   +G IS+
Sbjct: 280 REEESLENIKQYYVKCKNEEGKYNAIQNIYGCISV 314


>AE014296-3664|AAF51819.2|  749|Drosophila melanogaster CG11489-PB,
           isoform B protein.
          Length = 749

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = -3

Query: 79  VSNIIRQLCEALNDLH-KHNFIHNDIK 2
           V NIIRQ+ E L+ LH K + IH DIK
Sbjct: 389 VRNIIRQVLEGLDYLHSKCSIIHTDIK 415


>AE014296-3663|AAF51818.3|  816|Drosophila melanogaster CG11489-PC,
           isoform C protein.
          Length = 816

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 16/27 (59%), Positives = 19/27 (70%), Gaps = 1/27 (3%)
 Frame = -3

Query: 79  VSNIIRQLCEALNDLH-KHNFIHNDIK 2
           V NIIRQ+ E L+ LH K + IH DIK
Sbjct: 456 VRNIIRQVLEGLDYLHSKCSIIHTDIK 482


>AE014135-217|ABC65841.1|  828|Drosophila melanogaster CG40478-PE,
           isoform E protein.
          Length = 828

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = -3

Query: 202 NFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNIIRQLCEALNDLHK 29
           N I ++    F N+  I  + +   +L+E ++  G    S QLV      L + L+ L+K
Sbjct: 337 NIIHMFDYFTFRNHTCITFELLSI-NLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYK 395

Query: 28  HNFIHNDIK 2
           ++ IH D+K
Sbjct: 396 NDIIHCDMK 404


>AE014135-216|ABC65840.1|  828|Drosophila melanogaster CG40478-PD,
           isoform D protein.
          Length = 828

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = -3

Query: 202 NFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNIIRQLCEALNDLHK 29
           N I ++    F N+  I  + +   +L+E ++  G    S QLV      L + L+ L+K
Sbjct: 337 NIIHMFDYFTFRNHTCITFELLSI-NLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYK 395

Query: 28  HNFIHNDIK 2
           ++ IH D+K
Sbjct: 396 NDIIHCDMK 404


>AE014135-215|ABC65839.1|  828|Drosophila melanogaster CG40478-PC,
           isoform C protein.
          Length = 828

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = -3

Query: 202 NFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNIIRQLCEALNDLHK 29
           N I ++    F N+  I  + +   +L+E ++  G    S QLV      L + L+ L+K
Sbjct: 337 NIIHMFDYFTFRNHTCITFELLSI-NLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYK 395

Query: 28  HNFIHNDIK 2
           ++ IH D+K
Sbjct: 396 NDIIHCDMK 404


>AE014135-214|ABC65838.1|  828|Drosophila melanogaster CG40478-PB,
           isoform B protein.
          Length = 828

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = -3

Query: 202 NFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNIIRQLCEALNDLHK 29
           N I ++    F N+  I  + +   +L+E ++  G    S QLV      L + L+ L+K
Sbjct: 337 NIIHMFDYFTFRNHTCITFELLSI-NLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYK 395

Query: 28  HNFIHNDIK 2
           ++ IH D+K
Sbjct: 396 NDIIHCDMK 404


>AE014135-213|ABC65837.1|  828|Drosophila melanogaster CG40478-PA,
           isoform A protein.
          Length = 828

 Score = 30.3 bits (65), Expect = 3.3
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 2/69 (2%)
 Frame = -3

Query: 202 NFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKG--ELSHQLVSNIIRQLCEALNDLHK 29
           N I ++    F N+  I  + +   +L+E ++  G    S QLV      L + L+ L+K
Sbjct: 337 NIIHMFDYFTFRNHTCITFELLSI-NLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYK 395

Query: 28  HNFIHNDIK 2
           ++ IH D+K
Sbjct: 396 NDIIHCDMK 404


>L42962-1|AAC37267.1|  650|Drosophila melanogaster protein kinase
           protein.
          Length = 650

 Score = 29.9 bits (64), Expect = 4.3
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 3/83 (3%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GEL--SHQLVSN 71
           +EIK+H  +  H N ++   +        I M+ +    L + L+ K G L  +   ++ 
Sbjct: 130 EEIKLHSQLR-HRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAF 188

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
             +Q+ E L  LH+ + +H DIK
Sbjct: 189 YSKQILEGLKYLHEQDIVHRDIK 211


>AE014297-2723|AAS65178.1| 1196|Drosophila melanogaster CG4720-PB,
           isoform B protein.
          Length = 1196

 Score = 29.9 bits (64), Expect = 4.3
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 3/83 (3%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GEL--SHQLVSN 71
           +EIK+H  +  H N ++   +        I M+ +    L + L+ K G L  +   ++ 
Sbjct: 462 EEIKLHSQLR-HRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAF 520

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
             +Q+ E L  LH+ + +H DIK
Sbjct: 521 YSKQILEGLKYLHEQDIVHRDIK 543


>AE014297-2722|AAF55711.2| 1367|Drosophila melanogaster CG4720-PA,
           isoform A protein.
          Length = 1367

 Score = 29.9 bits (64), Expect = 4.3
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 3/83 (3%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GEL--SHQLVSN 71
           +EIK+H  +  H N ++   +        I M+ +    L + L+ K G L  +   ++ 
Sbjct: 633 EEIKLHSQLR-HRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAF 691

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
             +Q+ E L  LH+ + +H DIK
Sbjct: 692 YSKQILEGLKYLHEQDIVHRDIK 714


>AB038236-1|BAC16514.1| 1367|Drosophila melanogaster DASK1 protein.
          Length = 1367

 Score = 29.9 bits (64), Expect = 4.3
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 3/83 (3%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GEL--SHQLVSN 71
           +EIK+H  +  H N ++   +        I M+ +    L + L+ K G L  +   ++ 
Sbjct: 633 EEIKLHSQLR-HRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAF 691

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
             +Q+ E L  LH+ + +H DIK
Sbjct: 692 YSKQILEGLKYLHEQDIVHRDIK 714


>U73196-1|AAC47325.1|  353|Drosophila melanogaster Jun-N-terminal
           kinase protein.
          Length = 353

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+ +D  +L + +Q+  +L H  +S ++ Q+   +  LH    IH D+K
Sbjct: 104 LVMELMDA-NLCQVIQM--DLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLK 151


>U50966-1|AAB51188.1|  315|Drosophila melanogaster DJNK protein.
          Length = 315

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+ +D  +L + +Q+  +L H  +S ++ Q+   +  LH    IH D+K
Sbjct: 104 LVMELMDA-NLCQVIQM--DLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLK 151


>U50965-1|AAB51187.1|  372|Drosophila melanogaster DJNK protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+ +D  +L + +Q+  +L H  +S ++ Q+   +  LH    IH D+K
Sbjct: 104 LVMELMDA-NLCQVIQM--DLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLK 151


>U49249-1|AAB48381.1|  372|Drosophila melanogaster JNK protein
           kinase protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+ +D  +L + +Q+  +L H  +S ++ Q+   +  LH    IH D+K
Sbjct: 104 LVMELMDA-NLCQVIQM--DLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLK 151


>U49180-1|AAB97094.1|  372|Drosophila melanogaster JNK protein
           kinase protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+ +D  +L + +Q+  +L H  +S ++ Q+   +  LH    IH D+K
Sbjct: 104 LVMELMDA-NLCQVIQM--DLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLK 151


>BT023486-1|AAY84886.1| 1367|Drosophila melanogaster RE60627p
           protein.
          Length = 1367

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 3/83 (3%)
 Frame = -3

Query: 241 DEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GEL--SHQLVSN 71
           +EIK+H  +  H N ++   +        I M+ +    L + L+ K G L  +   ++ 
Sbjct: 633 EEIKLHSQLR-HRNIVRYLGSCSENGFFKIFMEQVPGGSLSDLLETKWGPLKDNESTMAF 691

Query: 70  IIRQLCEALNDLHKHNFIHNDIK 2
             +Q+ E L  LH+ + +H DIK
Sbjct: 692 YSKQVLEGLKYLHEQDIVHRDIK 714


>AY122221-1|AAM52733.1|  372|Drosophila melanogaster RE08746p
           protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+ +D  +L + +Q+  +L H  +S ++ Q+   +  LH    IH D+K
Sbjct: 104 LVMELMDA-NLCQVIQM--DLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLK 151


>AY070865-1|AAL48487.1|  372|Drosophila melanogaster HL02677p
           protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+ +D  +L + +Q+  +L H  +S ++ Q+   +  LH    IH D+K
Sbjct: 104 LVMELMDA-NLCQVIQM--DLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLK 151


>AY069129-1|AAL39274.1|  519|Drosophila melanogaster GH13884p
           protein.
          Length = 519

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +N   +M Y+   D F    I   L+   + + +R L  AL  +HK N IH D+K
Sbjct: 73  DNVAFIMPYMT-HDRFH--DIYRSLNFPEIRDYLRNLLIALRHVHKFNVIHRDVK 124


>AY051961-1|AAK93385.1|  512|Drosophila melanogaster LD42896p
           protein.
          Length = 512

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 17/85 (20%), Positives = 37/85 (43%)
 Frame = -3

Query: 256 ANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           AN    E+ + +++ D  + ++ +      + + I ++Y    +LF+ ++    +     
Sbjct: 62  ANSVRKEVCIQKMLQDK-HILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEA 120

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
                QL   LN LH+    H D+K
Sbjct: 121 QRYFTQLLSGLNYLHQRGIAHRDLK 145


>AF215861-1|AAF32288.1|  534|Drosophila melanogaster Myt1
           kinase-like protein protein.
          Length = 534

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNI 68
           ++E++ ++  + H N I+  F   +     + M    C +  E   ++ + +  + + +I
Sbjct: 147 LEEVRRYEEFSGHENCIR--FIRAWEQYDRLYMQMELCRESLEQYLLRCQRIPEERIWHI 204

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +  L   L  LH  N IH DIK
Sbjct: 205 LLDLLRGLKSLHDRNLIHLDIK 226


>AF057041-1|AAC13566.1|  513|Drosophila melanogaster Ser/Thr kinase
           protein.
          Length = 513

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 17/85 (20%), Positives = 37/85 (43%)
 Frame = -3

Query: 256 ANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           AN    E+ + +++ D  + ++ +      + + I ++Y    +LF+ ++    +     
Sbjct: 62  ANSVRKEVCIQKMLQDK-HILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEA 120

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
                QL   LN LH+    H D+K
Sbjct: 121 QRYFTQLLSGLNYLHQRGIAHRDLK 145


>AE014296-1005|AAF50747.3|  533|Drosophila melanogaster CG32417-PA
           protein.
          Length = 533

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = -3

Query: 244 VDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGE-LSHQLVSNI 68
           ++E++ ++  + H N I+  F   +     + M    C +  E   ++ + +  + + +I
Sbjct: 147 LEEVRRYEEFSGHENCIR--FIRAWEQYDRLYMQMELCRESLEQYLLRCQRIPEERIWHI 204

Query: 67  IRQLCEALNDLHKHNFIHNDIK 2
           +  L   L  LH  N IH DIK
Sbjct: 205 LLDLLRGLKSLHDRNLIHLDIK 226


>AE014134-2924|AAF53663.1|  665|Drosophila melanogaster CG5790-PA
           protein.
          Length = 665

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = -3

Query: 166 NNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +N   +M Y+   D F    I   L+   + + +R L  AL  +HK N IH D+K
Sbjct: 219 DNVAFIMPYMT-HDRFH--DIYRSLNFPEIRDYLRNLLIALRHVHKFNVIHRDVK 270


>AE014134-2748|AAF53551.2|  512|Drosophila melanogaster CG17161-PC,
           isoform C protein.
          Length = 512

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 17/85 (20%), Positives = 37/85 (43%)
 Frame = -3

Query: 256 ANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           AN    E+ + +++ D  + ++ +      + + I ++Y    +LF+ ++    +     
Sbjct: 62  ANSVRKEVCIQKMLQDK-HILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEA 120

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
                QL   LN LH+    H D+K
Sbjct: 121 QRYFTQLLSGLNYLHQRGIAHRDLK 145


>AE014134-2747|AAN10952.1|  512|Drosophila melanogaster CG17161-PB,
           isoform B protein.
          Length = 512

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 17/85 (20%), Positives = 37/85 (43%)
 Frame = -3

Query: 256 ANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           AN    E+ + +++ D  + ++ +      + + I ++Y    +LF+ ++    +     
Sbjct: 62  ANSVRKEVCIQKMLQDK-HILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEA 120

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
                QL   LN LH+    H D+K
Sbjct: 121 QRYFTQLLSGLNYLHQRGIAHRDLK 145


>AE014134-2746|AAF53552.2|  512|Drosophila melanogaster CG17161-PA,
           isoform A protein.
          Length = 512

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 17/85 (20%), Positives = 37/85 (43%)
 Frame = -3

Query: 256 ANFNVDEIKVHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLV 77
           AN    E+ + +++ D  + ++ +      + + I ++Y    +LF+ ++    +     
Sbjct: 62  ANSVRKEVCIQKMLQDK-HILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEA 120

Query: 76  SNIIRQLCEALNDLHKHNFIHNDIK 2
                QL   LN LH+    H D+K
Sbjct: 121 QRYFTQLLSGLNYLHQRGIAHRDLK 145


>AE014134-1794|AAF52883.1|  372|Drosophila melanogaster CG5680-PB
           protein.
          Length = 372

 Score = 29.5 bits (63), Expect = 5.7
 Identities = 15/51 (29%), Positives = 29/51 (56%)
 Frame = -3

Query: 154 IVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCEALNDLHKHNFIHNDIK 2
           +VM+ +D  +L + +Q+  +L H  +S ++ Q+   +  LH    IH D+K
Sbjct: 104 LVMELMDA-NLCQVIQM--DLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLK 151


>Y07908-1|CAA69216.1|  752|Drosophila melanogaster serine/threonine
           protein kinase protein.
          Length = 752

 Score = 29.1 bits (62), Expect = 7.5
 Identities = 17/76 (22%), Positives = 30/76 (39%)
 Frame = -3

Query: 229 VHQLMNDHPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIKGELSHQLVSNIIRQLCE 50
           +HQ+ N  P F+ +        +   VM Y    D+   +   G        +   +L  
Sbjct: 214 MHQMTNV-PGFVNLSCTFQDQRSLYFVMTYARKGDMLPYINRVGSFDVACTRHYAAELLL 272

Query: 49  ALNDLHKHNFIHNDIK 2
           A   +H+ N +H D+K
Sbjct: 273 ACEHMHRRNVVHRDLK 288


>X99512-1|CAA67862.1|  509|Drosophila melanogaster serine/threonine
           protein kinase protein.
          Length = 509

 Score = 29.1 bits (62), Expect = 7.5
 Identities = 19/70 (27%), Positives = 31/70 (44%), Gaps = 1/70 (1%)
 Frame = -3

Query: 208 HPNFIKIYFNHGFINNQVIVMDYIDCPDLFETLQIK-GELSHQLVSNIIRQLCEALNDLH 32
           H N + ++           V +Y D  DL + ++   G L H+ V   + QL   L+  H
Sbjct: 247 HSNIVTLHDIVHTRETLTFVFEYCDT-DLSQYMEKHPGGLDHRNVRLFLFQLLRGLSYCH 305

Query: 31  KHNFIHNDIK 2
           K   +H D+K
Sbjct: 306 KRRVLHRDVK 315


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,319,584
Number of Sequences: 53049
Number of extensions: 677912
Number of successful extensions: 3310
Number of sequences better than 10.0: 337
Number of HSP's better than 10.0 without gapping: 2978
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3291
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3798466620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -