SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120042.Seq
         (745 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-544|AAF45885.2|  159|Drosophila melanogaster CG13317-PA...    29   6.7  
AY058245-1|AAL13474.1|  421|Drosophila melanogaster GH01205p pro...    29   8.8  
AF181644-1|AAD55430.1|  719|Drosophila melanogaster BcDNA.GH1132...    29   8.8  
AE014134-719|AAF51028.2|  719|Drosophila melanogaster CG16857-PA...    29   8.8  

>AE014298-544|AAF45885.2|  159|Drosophila melanogaster CG13317-PA
           protein.
          Length = 159

 Score = 29.1 bits (62), Expect = 6.7
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = +1

Query: 178 WIHPRRANCKVTRPRNNYSDPDNENECCT 264
           W+H   AN  +   R++ + P   NECCT
Sbjct: 109 WLHVNYANMFLRSRRSDGNTPSISNECCT 137


>AY058245-1|AAL13474.1|  421|Drosophila melanogaster GH01205p
           protein.
          Length = 421

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 2/66 (3%)
 Frame = +2

Query: 491 HWQTGRD-EYILIADRMYVDLIYS-EFRAIILPQSAYIIKGDYAESDSESGQSVDVCNEL 664
           H Q G++ E+++++   Y D ++S +FR   LP        D  +   + GQ       L
Sbjct: 196 HLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAGGL 255

Query: 665 QYPWNL 682
             PWNL
Sbjct: 256 GAPWNL 261


>AF181644-1|AAD55430.1|  719|Drosophila melanogaster BcDNA.GH11322
           protein.
          Length = 719

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 2/66 (3%)
 Frame = +2

Query: 491 HWQTGRD-EYILIADRMYVDLIYS-EFRAIILPQSAYIIKGDYAESDSESGQSVDVCNEL 664
           H Q G++ E+++++   Y D ++S +FR   LP        D  +   + GQ       L
Sbjct: 494 HLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAGGL 553

Query: 665 QYPWNL 682
             PWNL
Sbjct: 554 GAPWNL 559


>AE014134-719|AAF51028.2|  719|Drosophila melanogaster CG16857-PA
           protein.
          Length = 719

 Score = 28.7 bits (61), Expect = 8.8
 Identities = 19/66 (28%), Positives = 31/66 (46%), Gaps = 2/66 (3%)
 Frame = +2

Query: 491 HWQTGRD-EYILIADRMYVDLIYS-EFRAIILPQSAYIIKGDYAESDSESGQSVDVCNEL 664
           H Q G++ E+++++   Y D ++S +FR   LP        D  +   + GQ       L
Sbjct: 494 HLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPSPIRADDFDAQQLQHDLGQVTAPAGGL 553

Query: 665 QYPWNL 682
             PWNL
Sbjct: 554 GAPWNL 559


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,320,674
Number of Sequences: 53049
Number of extensions: 587841
Number of successful extensions: 1571
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1531
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1568
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3375989364
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -