SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120041.Seq
         (827 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT004477-1|AAO42641.1| 1108|Drosophila melanogaster LP07504p pro...    31   2.5  
BT003233-1|AAO24988.1| 1108|Drosophila melanogaster LP06548p pro...    31   2.5  
AE014297-2975|AAF55880.4| 1108|Drosophila melanogaster CG16791-P...    31   2.5  
BT023115-1|AAY55531.1|  406|Drosophila melanogaster IP10861p pro...    30   3.4  
BT023063-1|AAY55479.1|  407|Drosophila melanogaster IP10961p pro...    30   3.4  
AE013599-627|AAF59107.2|  399|Drosophila melanogaster CG30371-PA...    30   3.4  
AL035311-6|CAA22951.1|  244|Drosophila melanogaster EG:52C10.2 p...    30   4.4  
AE013599-2569|AAF57785.1|  271|Drosophila melanogaster CG5036-PA...    30   4.4  

>BT004477-1|AAO42641.1| 1108|Drosophila melanogaster LP07504p
           protein.
          Length = 1108

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 20/67 (29%), Positives = 26/67 (38%)
 Frame = +2

Query: 401 YNNEEAVNVICDNLKYTEVSQAARNALYTAFTQLQEHSRHHKPEHVLFACVARRIAFFRR 580
           YNN    N IC        +++  N      TQ Q+H + H+  H      A R A F  
Sbjct: 5   YNNSYNYNYICSTTSPNN-NRSRNNKSREQDTQQQQHQQQHQQPHQQPMQAALRTASFSS 63

Query: 581 DQRPNAS 601
               NAS
Sbjct: 64  SSSSNAS 70


>BT003233-1|AAO24988.1| 1108|Drosophila melanogaster LP06548p
           protein.
          Length = 1108

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 20/67 (29%), Positives = 26/67 (38%)
 Frame = +2

Query: 401 YNNEEAVNVICDNLKYTEVSQAARNALYTAFTQLQEHSRHHKPEHVLFACVARRIAFFRR 580
           YNN    N IC        +++  N      TQ Q+H + H+  H      A R A F  
Sbjct: 5   YNNSYNYNYICSTTSPNN-NRSRNNKSREQDTQQQQHQQQHQQPHQQPMQAALRTASFSS 63

Query: 581 DQRPNAS 601
               NAS
Sbjct: 64  SSSSNAS 70


>AE014297-2975|AAF55880.4| 1108|Drosophila melanogaster CG16791-PA
           protein.
          Length = 1108

 Score = 30.7 bits (66), Expect = 2.5
 Identities = 20/67 (29%), Positives = 26/67 (38%)
 Frame = +2

Query: 401 YNNEEAVNVICDNLKYTEVSQAARNALYTAFTQLQEHSRHHKPEHVLFACVARRIAFFRR 580
           YNN    N IC        +++  N      TQ Q+H + H+  H      A R A F  
Sbjct: 5   YNNSYNYNYICSTTSPNN-NRSRNNKSREQDTQQQQHQQQHQQPHQQPMQAALRTASFSS 63

Query: 581 DQRPNAS 601
               NAS
Sbjct: 64  SSSSNAS 70


>BT023115-1|AAY55531.1|  406|Drosophila melanogaster IP10861p
           protein.
          Length = 406

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +2

Query: 323 PSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYT 451
           PS++ Y + +N+  M+  EQ +     NN+ AV +   N++++
Sbjct: 223 PSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWS 265


>BT023063-1|AAY55479.1|  407|Drosophila melanogaster IP10961p
           protein.
          Length = 407

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +2

Query: 323 PSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYT 451
           PS++ Y + +N+  M+  EQ +     NN+ AV +   N++++
Sbjct: 224 PSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWS 266


>AE013599-627|AAF59107.2|  399|Drosophila melanogaster CG30371-PA
           protein.
          Length = 399

 Score = 30.3 bits (65), Expect = 3.4
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = +2

Query: 323 PSATNYQEVFNLNSMMQAEQLIFHLIYNNEEAVNVICDNLKYT 451
           PS++ Y + +N+  M+  EQ +     NN+ AV +   N++++
Sbjct: 216 PSSSRYYQQYNIQQMIPHEQYVSDPDVNNDIAVLITASNIQWS 258


>AL035311-6|CAA22951.1|  244|Drosophila melanogaster EG:52C10.2
           protein.
          Length = 244

 Score = 29.9 bits (64), Expect = 4.4
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -3

Query: 546 ANKTCSGLWCLECSCSCVNAVYNA 475
           + K C   WC  CSCSC+ A+ NA
Sbjct: 85  SQKPCCFCWCCCCSCSCL-AIKNA 107


>AE013599-2569|AAF57785.1|  271|Drosophila melanogaster CG5036-PA
           protein.
          Length = 271

 Score = 29.9 bits (64), Expect = 4.4
 Identities = 12/24 (50%), Positives = 15/24 (62%)
 Frame = -3

Query: 546 ANKTCSGLWCLECSCSCVNAVYNA 475
           + K C   WC  CSCSC+ A+ NA
Sbjct: 85  SQKPCCFCWCCCCSCSCL-AIKNA 107


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 37,782,323
Number of Sequences: 53049
Number of extensions: 782591
Number of successful extensions: 2043
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 1977
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2040
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3921660132
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -