SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120040.Seq
         (757 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF220353-1|AAF32355.1| 2244|Drosophila melanogaster kinesin-like...    33   0.42 
AE014134-2053|AAF53088.2| 2013|Drosophila melanogaster CG6392-PA...    33   0.42 
AE014296-847|AAF47899.1|  604|Drosophila melanogaster CG15020-PA...    32   0.97 
AY061125-1|AAL28673.1| 1637|Drosophila melanogaster LD10743p pro...    30   3.0  
AL050231-2|CAB65850.1| 1624|Drosophila melanogaster EG:BACR37P7....    30   3.0  
AE014298-5|AAF45487.2| 1637|Drosophila melanogaster CG2995-PA pr...    30   3.0  
AE014134-1189|AAN10604.1|  234|Drosophila melanogaster CG32829-P...    30   3.0  
AY051969-1|AAK93393.1|  468|Drosophila melanogaster LD43488p pro...    30   3.9  
AE014297-3104|AAN13905.1|  673|Drosophila melanogaster CG5740-PB...    30   3.9  
AE014297-3103|AAF55957.3|  733|Drosophila melanogaster CG5740-PA...    30   3.9  

>AF220353-1|AAF32355.1| 2244|Drosophila melanogaster kinesin-like
           kinetochore motorprotein CENP-meta protein.
          Length = 2244

 Score = 33.1 bits (72), Expect = 0.42
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +2

Query: 317 SDKIDGFHDNIQYFK--DEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKY 478
           +DKI     ++Q F   ++H+ V C+    LK K A++    D  +++S+   E+Y
Sbjct: 505 TDKIKKEIQDLQMFTSLEKHFEVECEEVQGLKEKLAEVTAQRDNLEQESLAEKERY 560


>AE014134-2053|AAF53088.2| 2013|Drosophila melanogaster CG6392-PA
           protein.
          Length = 2013

 Score = 33.1 bits (72), Expect = 0.42
 Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 2/56 (3%)
 Frame = +2

Query: 317 SDKIDGFHDNIQYFK--DEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKY 478
           +DKI     ++Q F   ++H+ V C+    LK K A++    D  +++S+   E+Y
Sbjct: 505 TDKIKKEIQDLQMFTSLEKHFEVECEEVQGLKEKLAEVTAQRDNLEQESLAEKERY 560


>AE014296-847|AAF47899.1|  604|Drosophila melanogaster CG15020-PA
           protein.
          Length = 604

 Score = 31.9 bits (69), Expect = 0.97
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 3/50 (6%)
 Frame = +1

Query: 550 NGSN---QVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVLAYVDSVEFDG 690
           NG+N   Q++     P+ +K+I  F    +D+G+YE  V AY+ +  F G
Sbjct: 401 NGANKRIQLIDQHGCPVDDKLISRFRGSWSDSGVYETQVYAYMKTFRFTG 450


>AY061125-1|AAL28673.1| 1637|Drosophila melanogaster LD10743p
           protein.
          Length = 1637

 Score = 30.3 bits (65), Expect = 3.0
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = -1

Query: 670 PRKLRRRTRKVPCR*FREQTAQ*LCYQSGCTQKIALGCCRSQIP--ASTRIPPRSSVVFV 497
           P K R R  K PC     +T+  L + +G  +  + G C  Q+P  +  RI P   ++  
Sbjct: 463 PPKKRGRKAKTPCVKLESETSCGLPFANGNKKTNSSGGCELQLPKRSKRRIKPTPKILEN 522

Query: 496 DQL 488
           D+L
Sbjct: 523 DEL 525


>AL050231-2|CAB65850.1| 1624|Drosophila melanogaster EG:BACR37P7.2
           protein.
          Length = 1624

 Score = 30.3 bits (65), Expect = 3.0
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = -1

Query: 670 PRKLRRRTRKVPCR*FREQTAQ*LCYQSGCTQKIALGCCRSQIP--ASTRIPPRSSVVFV 497
           P K R R  K PC     +T+  L + +G  +  + G C  Q+P  +  RI P   ++  
Sbjct: 463 PPKKRGRKAKTPCVKLESETSCGLPFANGNKKTNSSGGCELQLPKRSKRRIKPTPKILEN 522

Query: 496 DQL 488
           D+L
Sbjct: 523 DEL 525


>AE014298-5|AAF45487.2| 1637|Drosophila melanogaster CG2995-PA
           protein.
          Length = 1637

 Score = 30.3 bits (65), Expect = 3.0
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 2/63 (3%)
 Frame = -1

Query: 670 PRKLRRRTRKVPCR*FREQTAQ*LCYQSGCTQKIALGCCRSQIP--ASTRIPPRSSVVFV 497
           P K R R  K PC     +T+  L + +G  +  + G C  Q+P  +  RI P   ++  
Sbjct: 463 PPKKRGRKAKTPCVKLESETSCGLPFANGNKKTNSSGGCELQLPKRSKRRIKPTPKILEN 522

Query: 496 DQL 488
           D+L
Sbjct: 523 DEL 525


>AE014134-1189|AAN10604.1|  234|Drosophila melanogaster CG32829-PA
           protein.
          Length = 234

 Score = 30.3 bits (65), Expect = 3.0
 Identities = 18/69 (26%), Positives = 33/69 (47%)
 Frame = +2

Query: 155 GVH*QDYEHAIDKTRSHDV*HFGSYTKRYAQEQHLRDRIKSKVDEQFDQLEREYSDKIDG 334
           G H +  +H   K + H   H G Y K +  E H + + + K  + F++ ++E+ +K   
Sbjct: 163 GEHKKGEKHEGGKKKGHKK-HHGHYKKGHHDEDHKKYKKEHKYGDSFEE-KKEHGEKGSK 220

Query: 335 FHDNIQYFK 361
            H +  Y K
Sbjct: 221 KHGHKHYKK 229


>AY051969-1|AAK93393.1|  468|Drosophila melanogaster LD43488p
           protein.
          Length = 468

 Score = 29.9 bits (64), Expect = 3.9
 Identities = 14/61 (22%), Positives = 32/61 (52%)
 Frame = +2

Query: 140 TNQRVGVH*QDYEHAIDKTRSHDV*HFGSYTKRYAQEQHLRDRIKSKVDEQFDQLEREYS 319
           TN+   V+  +   A+DK ++  +    + T RY   +   + ++S++D+  + LE++  
Sbjct: 144 TNELESVYVDERREALDKLQNEHIEELRALTNRYTANE---EELRSEIDDLHESLEQKKQ 200

Query: 320 D 322
           D
Sbjct: 201 D 201


>AE014297-3104|AAN13905.1|  673|Drosophila melanogaster CG5740-PB,
           isoform B protein.
          Length = 673

 Score = 29.9 bits (64), Expect = 3.9
 Identities = 14/61 (22%), Positives = 32/61 (52%)
 Frame = +2

Query: 140 TNQRVGVH*QDYEHAIDKTRSHDV*HFGSYTKRYAQEQHLRDRIKSKVDEQFDQLEREYS 319
           TN+   V+  +   A+DK ++  +    + T RY   +   + ++S++D+  + LE++  
Sbjct: 301 TNELESVYVDERREALDKLQNEHIEELRALTNRYTANE---EELRSEIDDLHESLEQKKQ 357

Query: 320 D 322
           D
Sbjct: 358 D 358


>AE014297-3103|AAF55957.3|  733|Drosophila melanogaster CG5740-PA,
           isoform A protein.
          Length = 733

 Score = 29.9 bits (64), Expect = 3.9
 Identities = 14/61 (22%), Positives = 32/61 (52%)
 Frame = +2

Query: 140 TNQRVGVH*QDYEHAIDKTRSHDV*HFGSYTKRYAQEQHLRDRIKSKVDEQFDQLEREYS 319
           TN+   V+  +   A+DK ++  +    + T RY   +   + ++S++D+  + LE++  
Sbjct: 361 TNELESVYVDERREALDKLQNEHIEELRALTNRYTANE---EELRSEIDDLHESLEQKKQ 417

Query: 320 D 322
           D
Sbjct: 418 D 418


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,070,950
Number of Sequences: 53049
Number of extensions: 670567
Number of successful extensions: 2095
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 2042
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2095
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3458330568
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -