SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120039.Seq
         (672 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT021407-1|AAX33555.1|  720|Drosophila melanogaster LD06749p pro...    41   0.001
AF162774-1|AAF68853.2|  720|Drosophila melanogaster Nopp140-like...    41   0.001
AE014296-3628|AAF51788.3|  720|Drosophila melanogaster CG7421-PA...    41   0.001
AE014296-3627|AAF51789.2|  686|Drosophila melanogaster CG7421-PB...    41   0.001
BT025071-1|ABE73242.1|  694|Drosophila melanogaster IP15312p pro...    31   1.1  
BT001809-1|AAN71564.1|  264|Drosophila melanogaster RH32892p pro...    31   1.1  
AE014135-48|AAS64602.1|  264|Drosophila melanogaster CG1674-PD, ...    31   1.1  
AE014135-47|AAF59357.1|  643|Drosophila melanogaster CG1674-PA, ...    31   1.1  
AE014135-46|AAN06522.1|  526|Drosophila melanogaster CG1674-PC, ...    31   1.1  
AY089581-1|AAL90319.1|  640|Drosophila melanogaster RE11224p pro...    31   1.4  
AE014135-45|AAN06521.1|  743|Drosophila melanogaster CG1674-PB, ...    31   1.4  
U21123-1|AAA85120.1|  684|Drosophila melanogaster ena polypeptid...    29   4.4  
AY084210-1|AAL89948.1|  831|Drosophila melanogaster SD08336p pro...    29   4.4  
AE013599-2829|AAM68439.1|  829|Drosophila melanogaster CG15112-P...    29   4.4  
AE013599-2828|AAX52697.1|  684|Drosophila melanogaster CG15112-P...    29   4.4  
AE013599-2827|AAM68438.2|  684|Drosophila melanogaster CG15112-P...    29   4.4  
AE013599-2826|AAF57598.2|  684|Drosophila melanogaster CG15112-P...    29   4.4  

>BT021407-1|AAX33555.1|  720|Drosophila melanogaster LD06749p
           protein.
          Length = 720

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 23/64 (35%), Positives = 40/64 (62%)
 Frame = +3

Query: 84  TEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGNKAKAKVP 263
           T++    +++V +YL+  DK+LA+ F +KTKA   AK+   L +I+ +F Q  K+  K+P
Sbjct: 2   TDLLKIADAIVLEYLQSKDKNLAKVFQQKTKAASVAKSSPKLSEIL-QFYQ-TKSPKKIP 59

Query: 264 VTRA 275
             +A
Sbjct: 60  AIKA 63


>AF162774-1|AAF68853.2|  720|Drosophila melanogaster Nopp140-like
           nucleolar protein protein.
          Length = 720

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 23/64 (35%), Positives = 40/64 (62%)
 Frame = +3

Query: 84  TEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGNKAKAKVP 263
           T++    +++V +YL+  DK+LA+ F +KTKA   AK+   L +I+ +F Q  K+  K+P
Sbjct: 2   TDLLKIADAIVLEYLQSKDKNLAKVFQQKTKAASVAKSSPKLSEIL-QFYQ-TKSPKKIP 59

Query: 264 VTRA 275
             +A
Sbjct: 60  AIKA 63


>AE014296-3628|AAF51788.3|  720|Drosophila melanogaster CG7421-PA,
           isoform A protein.
          Length = 720

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 23/64 (35%), Positives = 40/64 (62%)
 Frame = +3

Query: 84  TEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGNKAKAKVP 263
           T++    +++V +YL+  DK+LA+ F +KTKA   AK+   L +I+ +F Q  K+  K+P
Sbjct: 2   TDLLKIADAIVLEYLQSKDKNLAKVFQQKTKAASVAKSSPKLSEIL-QFYQ-TKSPKKIP 59

Query: 264 VTRA 275
             +A
Sbjct: 60  AIKA 63


>AE014296-3627|AAF51789.2|  686|Drosophila melanogaster CG7421-PB,
           isoform B protein.
          Length = 686

 Score = 41.1 bits (92), Expect = 0.001
 Identities = 23/64 (35%), Positives = 40/64 (62%)
 Frame = +3

Query: 84  TEIQADVNSLVHQYLEKIDKSLAQTFMKKTKAKPRAKNQQTLLDIIAKFNQGNKAKAKVP 263
           T++    +++V +YL+  DK+LA+ F +KTKA   AK+   L +I+ +F Q  K+  K+P
Sbjct: 2   TDLLKIADAIVLEYLQSKDKNLAKVFQQKTKAASVAKSSPKLSEIL-QFYQ-TKSPKKIP 59

Query: 264 VTRA 275
             +A
Sbjct: 60  AIKA 63


>BT025071-1|ABE73242.1|  694|Drosophila melanogaster IP15312p
           protein.
          Length = 694

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 7/133 (5%)
 Frame = +3

Query: 93  QADVNSLVHQYLEKIDKSLAQTFMKKTKA------KPRAKNQQTLLDIIAKFNQGNKAKA 254
           +AD+ SL    +     S +    + TKA      KP+  N Q +L+II+  +   KA+ 
Sbjct: 26  KADLVSLNEPNVNDQTSSASDLTAENTKADHDSLNKPKDFNNQ-ILNIISDIDINIKAQE 84

Query: 255 KVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH- 431
           K+         L+ Q+ K + K   L  ++  Q ++A  +S QN+      Q   L LH 
Sbjct: 85  KIT-------QLKEQELKLIQKQNDLANEIHKQQILAKQLSAQNQLKQNECQSGELDLHS 137

Query: 432 QLRNKNHQMTATV 470
           Q +N+    T+T+
Sbjct: 138 QYQNERGGPTSTL 150


>BT001809-1|AAN71564.1|  264|Drosophila melanogaster RH32892p
           protein.
          Length = 264

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 7/133 (5%)
 Frame = +3

Query: 93  QADVNSLVHQYLEKIDKSLAQTFMKKTKA------KPRAKNQQTLLDIIAKFNQGNKAKA 254
           +AD+ SL    +     S +    + TKA      KP+  N Q +L+II+  +   KA+ 
Sbjct: 26  KADLVSLNEPNVNDQTSSASDLTAENTKADHDSLNKPKDFNNQ-ILNIISDIDINIKAQE 84

Query: 255 KVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH- 431
           K+         L+ Q+ K + K   L  ++  Q ++A  +S QN+      Q   L LH 
Sbjct: 85  KIT-------QLKEQELKLIQKQNDLANEIHKQQILAKQLSAQNQLKQNECQSGELDLHS 137

Query: 432 QLRNKNHQMTATV 470
           Q +N+    T+T+
Sbjct: 138 QYQNERGGPTSTL 150


>AE014135-48|AAS64602.1|  264|Drosophila melanogaster CG1674-PD,
           isoform D protein.
          Length = 264

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 7/133 (5%)
 Frame = +3

Query: 93  QADVNSLVHQYLEKIDKSLAQTFMKKTKA------KPRAKNQQTLLDIIAKFNQGNKAKA 254
           +AD+ SL    +     S +    + TKA      KP+  N Q +L+II+  +   KA+ 
Sbjct: 26  KADLVSLNEPNVNDQTSSASDLTAENTKADHDSLNKPKDFNNQ-ILNIISDIDINIKAQE 84

Query: 255 KVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH- 431
           K+         L+ Q+ K + K   L  ++  Q ++A  +S QN+      Q   L LH 
Sbjct: 85  KIT-------QLKEQELKLIQKQNDLANEIHKQQILAKQLSAQNQLKQNECQSGELDLHS 137

Query: 432 QLRNKNHQMTATV 470
           Q +N+    T+T+
Sbjct: 138 QYQNERGGPTSTL 150


>AE014135-47|AAF59357.1|  643|Drosophila melanogaster CG1674-PA,
           isoform A protein.
          Length = 643

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 7/133 (5%)
 Frame = +3

Query: 93  QADVNSLVHQYLEKIDKSLAQTFMKKTKA------KPRAKNQQTLLDIIAKFNQGNKAKA 254
           +AD+ SL    +     S +    + TKA      KP+  N Q +L+II+  +   KA+ 
Sbjct: 216 KADLVSLNEPNVNDQTSSASDLTAENTKADHDSLNKPKDFNNQ-ILNIISDIDINIKAQE 274

Query: 255 KVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH- 431
           K+         L+ Q+ K + K   L  ++  Q ++A  +S QN+      Q   L LH 
Sbjct: 275 KIT-------QLKEQELKLIQKQNDLANEIHKQQILAKQLSAQNQLKQNECQSGELDLHS 327

Query: 432 QLRNKNHQMTATV 470
           Q +N+    T+T+
Sbjct: 328 QYQNERGGPTSTL 340


>AE014135-46|AAN06522.1|  526|Drosophila melanogaster CG1674-PC,
           isoform C protein.
          Length = 526

 Score = 31.5 bits (68), Expect = 1.1
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 7/133 (5%)
 Frame = +3

Query: 93  QADVNSLVHQYLEKIDKSLAQTFMKKTKA------KPRAKNQQTLLDIIAKFNQGNKAKA 254
           +AD+ SL    +     S +    + TKA      KP+  N Q +L+II+  +   KA+ 
Sbjct: 26  KADLVSLNEPNVNDQTSSASDLTAENTKADHDSLNKPKDFNNQ-ILNIISDIDINIKAQE 84

Query: 255 KVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLH- 431
           K+         L+ Q+ K + K   L  ++  Q ++A  +S QN+      Q   L LH 
Sbjct: 85  KIT-------QLKEQELKLIQKQNDLANEIHKQQILAKQLSAQNQLKQNECQSGELDLHS 137

Query: 432 QLRNKNHQMTATV 470
           Q +N+    T+T+
Sbjct: 138 QYQNERGGPTSTL 150


>AY089581-1|AAL90319.1|  640|Drosophila melanogaster RE11224p
           protein.
          Length = 640

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 1/98 (1%)
 Frame = +3

Query: 180 KPRAKNQQTLLDIIAKFNQGNKAKAKVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQIL 359
           KP+  N Q +L+II+  +   KA+ K+         L+ Q+ K + K   L  ++  Q +
Sbjct: 175 KPKDFNNQ-ILNIISDIDINIKAQEKIT-------QLKEQELKLIQKQNDLANEIHKQQI 226

Query: 360 VAPMMSHQNRHLSPTKQLKNLTLH-QLRNKNHQMTATV 470
           +A  +S QN+      Q   L LH Q +N+    T+T+
Sbjct: 227 LAKQLSAQNQLKQNECQSGELDLHSQYQNERGGPTSTL 264


>AE014135-45|AAN06521.1|  743|Drosophila melanogaster CG1674-PB,
           isoform B protein.
          Length = 743

 Score = 31.1 bits (67), Expect = 1.4
 Identities = 28/98 (28%), Positives = 48/98 (48%), Gaps = 1/98 (1%)
 Frame = +3

Query: 180 KPRAKNQQTLLDIIAKFNQGNKAKAKVPVTRAKKMPLRNQQFKQMGKFQQLRKKLKVQIL 359
           KP+  N Q +L+II+  +   KA+ K+         L+ Q+ K + K   L  ++  Q +
Sbjct: 278 KPKDFNNQ-ILNIISDIDINIKAQEKIT-------QLKEQELKLIQKQNDLANEIHKQQI 329

Query: 360 VAPMMSHQNRHLSPTKQLKNLTLH-QLRNKNHQMTATV 470
           +A  +S QN+      Q   L LH Q +N+    T+T+
Sbjct: 330 LAKQLSAQNQLKQNECQSGELDLHSQYQNERGGPTSTL 367


>U21123-1|AAA85120.1|  684|Drosophila melanogaster ena polypeptide
           protein.
          Length = 684

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +3

Query: 291 RNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQLRNKNHQ 455
           + QQF+Q  + QQ ++   VQ   AP   +Q  H   +    NLT+HQ   +  Q
Sbjct: 242 QQQQFQQQQQQQQYQQM--VQAGYAPSQQYQQPHYVLSNSNPNLTVHQYPTQQAQ 294


>AY084210-1|AAL89948.1|  831|Drosophila melanogaster SD08336p
           protein.
          Length = 831

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +3

Query: 291 RNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQLRNKNHQ 455
           + QQF+Q  + QQ ++   VQ   AP   +Q  H   +    NLT+HQ   +  Q
Sbjct: 388 QQQQFQQQQQQQQYQQM--VQAGYAPSQQYQQPHYVLSNSNPNLTVHQYPTQQAQ 440


>AE013599-2829|AAM68439.1|  829|Drosophila melanogaster CG15112-PB,
           isoform B protein.
          Length = 829

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +3

Query: 291 RNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQLRNKNHQ 455
           + QQF+Q  + QQ ++   VQ   AP   +Q  H   +    NLT+HQ   +  Q
Sbjct: 387 QQQQFQQQQQQQQYQQM--VQAGYAPSQQYQQPHYVLSNSNPNLTVHQYPTQQAQ 439


>AE013599-2828|AAX52697.1|  684|Drosophila melanogaster CG15112-PE,
           isoform E protein.
          Length = 684

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +3

Query: 291 RNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQLRNKNHQ 455
           + QQF+Q  + QQ ++   VQ   AP   +Q  H   +    NLT+HQ   +  Q
Sbjct: 242 QQQQFQQQQQQQQYQQM--VQAGYAPSQQYQQPHYVLSNSNPNLTVHQYPTQQAQ 294


>AE013599-2827|AAM68438.2|  684|Drosophila melanogaster CG15112-PC,
           isoform C protein.
          Length = 684

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +3

Query: 291 RNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQLRNKNHQ 455
           + QQF+Q  + QQ ++   VQ   AP   +Q  H   +    NLT+HQ   +  Q
Sbjct: 242 QQQQFQQQQQQQQYQQM--VQAGYAPSQQYQQPHYVLSNSNPNLTVHQYPTQQAQ 294


>AE013599-2826|AAF57598.2|  684|Drosophila melanogaster CG15112-PA,
           isoform A protein.
          Length = 684

 Score = 29.5 bits (63), Expect = 4.4
 Identities = 18/55 (32%), Positives = 27/55 (49%)
 Frame = +3

Query: 291 RNQQFKQMGKFQQLRKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQLRNKNHQ 455
           + QQF+Q  + QQ ++   VQ   AP   +Q  H   +    NLT+HQ   +  Q
Sbjct: 242 QQQQFQQQQQQQQYQQM--VQAGYAPSQQYQQPHYVLSNSNPNLTVHQYPTQQAQ 294


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,841,080
Number of Sequences: 53049
Number of extensions: 371152
Number of successful extensions: 1476
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1386
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1476
length of database: 24,988,368
effective HSP length: 82
effective length of database: 20,638,350
effective search space used: 2910007350
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -