SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120035.Seq
         (749 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT003187-1|AAO24942.1|  629|Drosophila melanogaster RE63465p pro...    31   1.7  
AY058246-1|AAL13475.1|  797|Drosophila melanogaster GH01206p pro...    31   1.7  
AE014134-573|AAF51132.3|  797|Drosophila melanogaster CG3332-PA,...    31   1.7  
AE014134-572|AAN10385.1|  629|Drosophila melanogaster CG3332-PB,...    31   1.7  
M25292-1|AAA17840.1|  397|Drosophila melanogaster dsx protein.         29   6.8  
BT029258-1|ABK30895.1|  427|Drosophila melanogaster FI01107p pro...    29   6.8  
AY060257-1|AAL25296.1|  427|Drosophila melanogaster GH08308p pro...    29   6.8  
AE014297-676|AAF54168.2|  427|Drosophila melanogaster CG11094-PC...    29   6.8  
AE014297-675|AAN13385.1|  427|Drosophila melanogaster CG11094-PB...    29   6.8  
AE014297-674|AAF54169.1|  549|Drosophila melanogaster CG11094-PA...    29   6.8  
U04246-1|AAA62472.1| 1284|Drosophila melanogaster putative potas...    29   8.9  
AE013599-2592|AAF57772.2| 1284|Drosophila melanogaster CG5076-PA...    29   8.9  

>BT003187-1|AAO24942.1|  629|Drosophila melanogaster RE63465p
           protein.
          Length = 629

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 16/30 (53%), Positives = 17/30 (56%)
 Frame = +3

Query: 51  INFNASYTSAPTPSRASFDNGYSEFCDKQQ 140
           INF +  TSA   S A FDNG   F  KQQ
Sbjct: 32  INFQSGATSARNGSTAFFDNGAKSFQAKQQ 61


>AY058246-1|AAL13475.1|  797|Drosophila melanogaster GH01206p
           protein.
          Length = 797

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 16/30 (53%), Positives = 17/30 (56%)
 Frame = +3

Query: 51  INFNASYTSAPTPSRASFDNGYSEFCDKQQ 140
           INF +  TSA   S A FDNG   F  KQQ
Sbjct: 200 INFQSGATSARNGSTAFFDNGAKSFQAKQQ 229


>AE014134-573|AAF51132.3|  797|Drosophila melanogaster CG3332-PA,
           isoform A protein.
          Length = 797

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 16/30 (53%), Positives = 17/30 (56%)
 Frame = +3

Query: 51  INFNASYTSAPTPSRASFDNGYSEFCDKQQ 140
           INF +  TSA   S A FDNG   F  KQQ
Sbjct: 200 INFQSGATSARNGSTAFFDNGAKSFQAKQQ 229


>AE014134-572|AAN10385.1|  629|Drosophila melanogaster CG3332-PB,
           isoform B protein.
          Length = 629

 Score = 31.1 bits (67), Expect = 1.7
 Identities = 16/30 (53%), Positives = 17/30 (56%)
 Frame = +3

Query: 51  INFNASYTSAPTPSRASFDNGYSEFCDKQQ 140
           INF +  TSA   S A FDNG   F  KQQ
Sbjct: 32  INFQSGATSARNGSTAFFDNGAKSFQAKQQ 61


>M25292-1|AAA17840.1|  397|Drosophila melanogaster dsx protein.
          Length = 397

 Score = 29.1 bits (62), Expect = 6.8
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 364 PSPSSAYNAESFEQSVGVNQPSAAGTKRKLDEYLDDSQSVVGQF 495
           PSPSS   A     SV VN+ + A      D +LD  Q ++ +F
Sbjct: 324 PSPSSTSGAAILPISVSVNRKNGANVPLGQDVFLDYCQKLLEKF 367


>BT029258-1|ABK30895.1|  427|Drosophila melanogaster FI01107p
           protein.
          Length = 427

 Score = 29.1 bits (62), Expect = 6.8
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 364 PSPSSAYNAESFEQSVGVNQPSAAGTKRKLDEYLDDSQSVVGQF 495
           PSPSS   A     SV VN+ + A      D +LD  Q ++ +F
Sbjct: 324 PSPSSTSGAAILPISVSVNRKNGANVPLGQDVFLDYCQKLLEKF 367


>AY060257-1|AAL25296.1|  427|Drosophila melanogaster GH08308p
           protein.
          Length = 427

 Score = 29.1 bits (62), Expect = 6.8
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 364 PSPSSAYNAESFEQSVGVNQPSAAGTKRKLDEYLDDSQSVVGQF 495
           PSPSS   A     SV VN+ + A      D +LD  Q ++ +F
Sbjct: 324 PSPSSTSGAAILPISVSVNRKNGANVPLGQDVFLDYCQKLLEKF 367


>AE014297-676|AAF54168.2|  427|Drosophila melanogaster CG11094-PC,
           isoform C protein.
          Length = 427

 Score = 29.1 bits (62), Expect = 6.8
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 364 PSPSSAYNAESFEQSVGVNQPSAAGTKRKLDEYLDDSQSVVGQF 495
           PSPSS   A     SV VN+ + A      D +LD  Q ++ +F
Sbjct: 324 PSPSSTSGAAILPISVSVNRKNGANVPLGQDVFLDYCQKLLEKF 367


>AE014297-675|AAN13385.1|  427|Drosophila melanogaster CG11094-PB,
           isoform B protein.
          Length = 427

 Score = 29.1 bits (62), Expect = 6.8
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 364 PSPSSAYNAESFEQSVGVNQPSAAGTKRKLDEYLDDSQSVVGQF 495
           PSPSS   A     SV VN+ + A      D +LD  Q ++ +F
Sbjct: 324 PSPSSTSGAAILPISVSVNRKNGANVPLGQDVFLDYCQKLLEKF 367


>AE014297-674|AAF54169.1|  549|Drosophila melanogaster CG11094-PA,
           isoform A protein.
          Length = 549

 Score = 29.1 bits (62), Expect = 6.8
 Identities = 16/44 (36%), Positives = 22/44 (50%)
 Frame = +1

Query: 364 PSPSSAYNAESFEQSVGVNQPSAAGTKRKLDEYLDDSQSVVGQF 495
           PSPSS   A     SV VN+ + A      D +LD  Q ++ +F
Sbjct: 324 PSPSSTSGAAILPISVSVNRKNGANVPLGQDVFLDYCQKLLEKF 367


>U04246-1|AAA62472.1| 1284|Drosophila melanogaster putative potassium
            channel subunit protein.
          Length = 1284

 Score = 28.7 bits (61), Expect = 8.9
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = -3

Query: 225  KLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTT 97
            +L+ S     P R++P  D  N+++ RW + +  + +S C++T
Sbjct: 1050 RLITSSAVPTPGRIYPPLDDENSNDFRWTMKHSASHHSCCKST 1092


>AE013599-2592|AAF57772.2| 1284|Drosophila melanogaster CG5076-PA
            protein.
          Length = 1284

 Score = 28.7 bits (61), Expect = 8.9
 Identities = 12/43 (27%), Positives = 25/43 (58%)
 Frame = -3

Query: 225  KLLQSRCQILPCRLHPAWDCYNNSNSRWAVVYHKTLNSRCRTT 97
            +L+ S     P R++P  D  N+++ RW + +  + +S C++T
Sbjct: 1050 RLITSSAVPTPGRIYPPLDDENSNDFRWTMKHSASHHSCCKST 1092


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,360,379
Number of Sequences: 53049
Number of extensions: 700650
Number of successful extensions: 3168
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 2775
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3168
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3417159966
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -