SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120033.Seq
         (717 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF167431-1|AAF06736.1| 2173|Drosophila melanogaster sulfonyl ure...    30   3.6  
AE014134-1771|AAF52866.3| 2177|Drosophila melanogaster CG5772-PA...    30   3.6  
U28136-1|AAA68953.1| 2146|Drosophila melanogaster insulin recept...    29   6.3  
U18351-1|AAC47458.1| 2148|Drosophila melanogaster insulin recept...    29   6.3  
AE014297-3020|AAF55903.2| 2144|Drosophila melanogaster CG18402-P...    29   6.3  

>AF167431-1|AAF06736.1| 2173|Drosophila melanogaster sulfonyl urea
            receptor protein.
          Length = 2173

 Score = 29.9 bits (64), Expect = 3.6
 Identities = 13/31 (41%), Positives = 22/31 (70%)
 Frame = +3

Query: 339  EAGEHNMGVLKIIIDTVIKYIGKLADDEYIL 431
            E+G  +M + ++ IDT  KY GK++DD Y++
Sbjct: 1388 ESGRESMPLARLAIDTERKY-GKISDDIYLM 1417


>AE014134-1771|AAF52866.3| 2177|Drosophila melanogaster CG5772-PA
            protein.
          Length = 2177

 Score = 29.9 bits (64), Expect = 3.6
 Identities = 13/31 (41%), Positives = 22/31 (70%)
 Frame = +3

Query: 339  EAGEHNMGVLKIIIDTVIKYIGKLADDEYIL 431
            E+G  +M + ++ IDT  KY GK++DD Y++
Sbjct: 1388 ESGRESMPLARLAIDTERKY-GKISDDIYLM 1417


>U28136-1|AAA68953.1| 2146|Drosophila melanogaster insulin receptor
           homolog protein.
          Length = 2146

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%)
 Frame = +2

Query: 317 GTF*KRRRGWRTQ--HGRFKDHHRYGHQVHWQTGRRRVHF 430
           G F KRRR    Q  H  ++ HH+  HQ H Q  +  V +
Sbjct: 167 GIFNKRRRRQHQQQHHHHYQHHHQQHHQQHLQRQQANVSY 206


>U18351-1|AAC47458.1| 2148|Drosophila melanogaster insulin receptor
           protein.
          Length = 2148

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%)
 Frame = +2

Query: 317 GTF*KRRRGWRTQ--HGRFKDHHRYGHQVHWQTGRRRVHF 430
           G F KRRR    Q  H  ++ HH+  HQ H Q  +  V +
Sbjct: 171 GIFNKRRRRQHQQQHHHHYQHHHQQHHQQHLQRQQANVSY 210


>AE014297-3020|AAF55903.2| 2144|Drosophila melanogaster CG18402-PA
           protein.
          Length = 2144

 Score = 29.1 bits (62), Expect = 6.3
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%)
 Frame = +2

Query: 317 GTF*KRRRGWRTQ--HGRFKDHHRYGHQVHWQTGRRRVHF 430
           G F KRRR    Q  H  ++ HH+  HQ H Q  +  V +
Sbjct: 167 GIFNKRRRRQHQQQHHHHYQHHHQQHHQQHHQRQQANVSY 206


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 28,499,242
Number of Sequences: 53049
Number of extensions: 566335
Number of successful extensions: 1759
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1699
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1756
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3190721655
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -