SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120031.Seq
         (726 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

X98310-1|CAA66954.1|  503|Drosophila melanogaster ARI protein pr...    29   4.9  
X98309-1|CAA66953.1|  503|Drosophila melanogaster ARI protein pr...    29   4.9  
BT004849-1|AAO45205.1|  197|Drosophila melanogaster RE69116p pro...    29   4.9  
AE014298-2679|AAS65398.1|  503|Drosophila melanogaster CG5659-PC...    29   4.9  
AE014298-2678|AAF48807.1|  503|Drosophila melanogaster CG5659-PB...    29   4.9  
AE014298-2677|AAN09462.1|  503|Drosophila melanogaster CG5659-PA...    29   4.9  

>X98310-1|CAA66954.1|  503|Drosophila melanogaster ARI protein
           protein.
          Length = 503

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 16/73 (21%), Positives = 34/73 (46%), Gaps = 2/73 (2%)
 Frame = +2

Query: 275 KLLSSQATYLYHFACLMKYKDIQKYE--VQQLIEWAINASPDMDLQQFRIEFMDKTTELN 448
           KL SS A YL+++   M +    K+E  +   ++  +      ++    ++F+ K  ++ 
Sbjct: 353 KLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKMEEMQQHNMSWIEVQFLKKAVDIL 412

Query: 449 LRSCQPKSFTYTF 487
            +  Q   +TY F
Sbjct: 413 CQCRQTLMYTYVF 425


>X98309-1|CAA66953.1|  503|Drosophila melanogaster ARI protein
           protein.
          Length = 503

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 16/73 (21%), Positives = 34/73 (46%), Gaps = 2/73 (2%)
 Frame = +2

Query: 275 KLLSSQATYLYHFACLMKYKDIQKYE--VQQLIEWAINASPDMDLQQFRIEFMDKTTELN 448
           KL SS A YL+++   M +    K+E  +   ++  +      ++    ++F+ K  ++ 
Sbjct: 353 KLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKMEEMQQHNMSWIEVQFLKKAVDIL 412

Query: 449 LRSCQPKSFTYTF 487
            +  Q   +TY F
Sbjct: 413 CQCRQTLMYTYVF 425


>BT004849-1|AAO45205.1|  197|Drosophila melanogaster RE69116p
           protein.
          Length = 197

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 16/73 (21%), Positives = 34/73 (46%), Gaps = 2/73 (2%)
 Frame = +2

Query: 275 KLLSSQATYLYHFACLMKYKDIQKYE--VQQLIEWAINASPDMDLQQFRIEFMDKTTELN 448
           KL SS A YL+++   M +    K+E  +   ++  +      ++    ++F+ K  ++ 
Sbjct: 47  KLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKMEEMQQHNMSWIEVQFLKKAVDIL 106

Query: 449 LRSCQPKSFTYTF 487
            +  Q   +TY F
Sbjct: 107 CQCRQTLMYTYVF 119


>AE014298-2679|AAS65398.1|  503|Drosophila melanogaster CG5659-PC,
           isoform C protein.
          Length = 503

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 16/73 (21%), Positives = 34/73 (46%), Gaps = 2/73 (2%)
 Frame = +2

Query: 275 KLLSSQATYLYHFACLMKYKDIQKYE--VQQLIEWAINASPDMDLQQFRIEFMDKTTELN 448
           KL SS A YL+++   M +    K+E  +   ++  +      ++    ++F+ K  ++ 
Sbjct: 353 KLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKMEEMQQHNMSWIEVQFLKKAVDIL 412

Query: 449 LRSCQPKSFTYTF 487
            +  Q   +TY F
Sbjct: 413 CQCRQTLMYTYVF 425


>AE014298-2678|AAF48807.1|  503|Drosophila melanogaster CG5659-PB,
           isoform B protein.
          Length = 503

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 16/73 (21%), Positives = 34/73 (46%), Gaps = 2/73 (2%)
 Frame = +2

Query: 275 KLLSSQATYLYHFACLMKYKDIQKYE--VQQLIEWAINASPDMDLQQFRIEFMDKTTELN 448
           KL SS A YL+++   M +    K+E  +   ++  +      ++    ++F+ K  ++ 
Sbjct: 353 KLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKMEEMQQHNMSWIEVQFLKKAVDIL 412

Query: 449 LRSCQPKSFTYTF 487
            +  Q   +TY F
Sbjct: 413 CQCRQTLMYTYVF 425


>AE014298-2677|AAN09462.1|  503|Drosophila melanogaster CG5659-PA,
           isoform A protein.
          Length = 503

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 16/73 (21%), Positives = 34/73 (46%), Gaps = 2/73 (2%)
 Frame = +2

Query: 275 KLLSSQATYLYHFACLMKYKDIQKYE--VQQLIEWAINASPDMDLQQFRIEFMDKTTELN 448
           KL SS A YL+++   M +    K+E  +   ++  +      ++    ++F+ K  ++ 
Sbjct: 353 KLRSSLARYLHYYNRYMNHMQSMKFENKLYASVKQKMEEMQQHNMSWIEVQFLKKAVDIL 412

Query: 449 LRSCQPKSFTYTF 487
            +  Q   +TY F
Sbjct: 413 CQCRQTLMYTYVF 425


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 32,367,591
Number of Sequences: 53049
Number of extensions: 696236
Number of successful extensions: 2072
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 1955
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2070
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3252477558
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -