SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120028.Seq
         (721 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY071207-1|AAL48829.2|  195|Drosophila melanogaster RE25242p pro...    31   1.6  
AE013599-2493|AAF57848.2|  195|Drosophila melanogaster CG11419-P...    31   1.6  
AY075577-1|AAL68382.1| 1489|Drosophila melanogaster SD05887p pro...    31   2.1  
AE013599-3585|AAF46990.2| 1489|Drosophila melanogaster CG3493-PA...    31   2.1  
AE014298-1343|AAF46505.2| 3687|Drosophila melanogaster CG32702-P...    29   6.4  

>AY071207-1|AAL48829.2|  195|Drosophila melanogaster RE25242p
           protein.
          Length = 195

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = +1

Query: 280 GLEIAHDDILDCNWDSD-QVYHLNEIIFHKQ 369
           G+E   D+I+D  W SD Q+ HL  I FHK+
Sbjct: 49  GVERLRDNIMDTYWQSDGQLPHLVNIQFHKR 79


>AE013599-2493|AAF57848.2|  195|Drosophila melanogaster CG11419-PA
           protein.
          Length = 195

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = +1

Query: 280 GLEIAHDDILDCNWDSD-QVYHLNEIIFHKQ 369
           G+E   D+I+D  W SD Q+ HL  I FHK+
Sbjct: 49  GVERLRDNIMDTYWQSDGQLPHLVNIQFHKR 79


>AY075577-1|AAL68382.1| 1489|Drosophila melanogaster SD05887p
           protein.
          Length = 1489

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 20/79 (25%), Positives = 42/79 (53%)
 Frame = +3

Query: 423 VVENFDAVKF*QQKQRVAAPSN*RRA**LRDKIESVLKHVKKLNTNSEKFMVTHETFKND 602
           V E ++AV+  Q+++ V   +  ++A  +  ++E     V+KL    ++     E+  N+
Sbjct: 300 VTEKYEAVRK-QEEENVLLLAQTKQA--IHTELELKDTEVRKLQEKLKQLESQRESHNNE 356

Query: 603 VGNRFEQFELRLNELDAKL 659
           V  +F++ +    E+DAKL
Sbjct: 357 VKEQFKKLQATKQEVDAKL 375


>AE013599-3585|AAF46990.2| 1489|Drosophila melanogaster CG3493-PA
           protein.
          Length = 1489

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 20/79 (25%), Positives = 42/79 (53%)
 Frame = +3

Query: 423 VVENFDAVKF*QQKQRVAAPSN*RRA**LRDKIESVLKHVKKLNTNSEKFMVTHETFKND 602
           V E ++AV+  Q+++ V   +  ++A  +  ++E     V+KL    ++     E+  N+
Sbjct: 300 VTEKYEAVRK-QEEENVLLLAQTKQA--IHTELELKDTEVRKLQEKLKQLESQRESHNNE 356

Query: 603 VGNRFEQFELRLNELDAKL 659
           V  +F++ +    E+DAKL
Sbjct: 357 VKEQFKKLQATKQEVDAKL 375


>AE014298-1343|AAF46505.2| 3687|Drosophila melanogaster CG32702-PA
            protein.
          Length = 3687

 Score = 29.1 bits (62), Expect = 6.4
 Identities = 14/49 (28%), Positives = 25/49 (51%)
 Frame = +1

Query: 205  HAQFQVQIRAQRHERKIYNVIDFCKGLEIAHDDILDCNWDSDQVYHLNE 351
            H++ + Q+   +H + ++ + D    LE  +D    CNWD  + Y L E
Sbjct: 1530 HSRCEWQVEVSQHHQIVFEMADL--NLESGYD----CNWDYLEAYDLTE 1572


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 27,135,743
Number of Sequences: 53049
Number of extensions: 524706
Number of successful extensions: 1458
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1424
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1458
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3211306956
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -