SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120026.Seq
         (729 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE013599-545|AAF59166.2|  922|Drosophila melanogaster CG14766-PA...    30   3.7  
DQ902587-1|ABI94369.1| 2009|Drosophila melanogaster calmodulin-b...    29   6.5  
BT022415-1|AAY54831.1|  189|Drosophila melanogaster IP08052p pro...    29   8.6  
AE014297-718|AAF54205.4|  227|Drosophila melanogaster CG18228-PA...    29   8.6  

>AE013599-545|AAF59166.2|  922|Drosophila melanogaster CG14766-PA
           protein.
          Length = 922

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)
 Frame = +2

Query: 566 PASKKRQTAVLTNANLA--ELKESCEMRDKLYSEFYSLLNETFNNNVAPL 709
           P S+KR+   +T  N +  E K        LYS +  +++ET  N  +PL
Sbjct: 827 PVSEKRELISITKPNQSDCEAKHRSHKDVNLYSRYPKIISETLENLTSPL 876


>DQ902587-1|ABI94369.1| 2009|Drosophila melanogaster
            calmodulin-binding transcriptionactivator protein.
          Length = 2009

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 13/33 (39%), Positives = 18/33 (54%)
 Frame = +1

Query: 145  NMPEQQSSTETAAVCKNEKLLNKLESSSYNKSN 243
            N  +Q ++T TAA C N K  N L   S+  +N
Sbjct: 1021 NQQQQITTTSTAATCDNLKSANALSEDSHTVNN 1053


>BT022415-1|AAY54831.1|  189|Drosophila melanogaster IP08052p
           protein.
          Length = 189

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +3

Query: 261 IVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIK-QPEWPSSPA 437
           I+N  +K+ +N++       +D+  + K  +  ++NN+  L  SWYT ++  P+ P +  
Sbjct: 127 ILNLWQKEAVNFV-----GQRDDVIVVKGARAQLHNNEMKLNASWYTNMQINPDIPDATG 181

Query: 438 MWDLVKN 458
           M +   N
Sbjct: 182 MLEWYNN 188


>AE014297-718|AAF54205.4|  227|Drosophila melanogaster CG18228-PA
           protein.
          Length = 227

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 17/67 (25%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +3

Query: 261 IVNFLEKKNINYILNVMPVMQDERKMSKRKKKVINNNKYILFNSWYTKIK-QPEWPSSPA 437
           I+N  +K+ +N++       +D+  + K  +  ++NN+  L  SWYT ++  P+ P +  
Sbjct: 165 ILNLWQKEAVNFV-----GQRDDVIVVKGARAQLHNNEMKLNASWYTNMQINPDIPDATG 219

Query: 438 MWDLVKN 458
           M +   N
Sbjct: 220 MLEWYNN 226


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,103,812
Number of Sequences: 53049
Number of extensions: 721967
Number of successful extensions: 1955
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 1776
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1955
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3273062859
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -