SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120024.Seq
         (770 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY118729-1|AAM50589.1|  286|Drosophila melanogaster GH03475p pro...   111   1e-24
AE014297-2761|AAF55741.1|  286|Drosophila melanogaster CG4390-PA...   111   1e-24
AE014297-2760|AAN13821.2|  330|Drosophila melanogaster CG4390-PB...   111   1e-24
AY051575-1|AAK92999.1|  560|Drosophila melanogaster GH22314p pro...    30   4.0  
U73846-1|AAB61993.1|  808|Drosophila melanogaster testis-specifi...    29   9.3  

>AY118729-1|AAM50589.1|  286|Drosophila melanogaster GH03475p
           protein.
          Length = 286

 Score =  111 bits (267), Expect = 1e-24
 Identities = 54/111 (48%), Positives = 72/111 (64%), Gaps = 2/111 (1%)
 Frame = +1

Query: 163 IKMQNEFFYLSPPSGRRG*CEITTSILFVWS--TCSEQNFITKSGFQRYAAEHGVIVVGP 336
           +K    F    PP+   G       +LF  S  TC+ +NFI KSGFQ++AA H +IVV P
Sbjct: 26  LKCDMTFGVFLPPAALEG---KPCPVLFFLSGLTCTHENFIQKSGFQQHAARHNLIVVNP 82

Query: 337 DTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDLI 489
           DTSPRGV+I G D ++DFG  AGFY+DA  EPW+ +Y+M SY+  EL D++
Sbjct: 83  DTSPRGVEIAGQDDAYDFGSGAGFYVDAKEEPWSKHYKMYSYVTQELVDVV 133



 Score = 93.5 bits (222), Expect = 3e-19
 Identities = 39/68 (57%), Positives = 48/68 (70%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGP 740
           AL+  L+NPG Y+SVSAFA I NP+ CPWG KAF+GYLG +   WA WDAT LV +Y   
Sbjct: 156 ALICALKNPGLYQSVSAFAPIANPTECPWGKKAFAGYLGSNPDDWALWDATHLVSQYEST 215

Query: 741 PLTLLLDR 764
           P  L +D+
Sbjct: 216 PQELFIDQ 223



 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 26/54 (48%), Positives = 35/54 (64%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           +L+  S+NK F G Q+VY H S  LKC M F ++LPP A  G    P+L++LSG
Sbjct: 2   TLEQLSANKCFEGEQRVYRHRSDTLKCDMTFGVFLPPAALEGK-PCPVLFFLSG 54


>AE014297-2761|AAF55741.1|  286|Drosophila melanogaster CG4390-PA,
           isoform A protein.
          Length = 286

 Score =  111 bits (267), Expect = 1e-24
 Identities = 54/111 (48%), Positives = 72/111 (64%), Gaps = 2/111 (1%)
 Frame = +1

Query: 163 IKMQNEFFYLSPPSGRRG*CEITTSILFVWS--TCSEQNFITKSGFQRYAAEHGVIVVGP 336
           +K    F    PP+   G       +LF  S  TC+ +NFI KSGFQ++AA H +IVV P
Sbjct: 26  LKCDMTFGVFLPPAALEG---KPCPVLFFLSGLTCTHENFIQKSGFQQHAARHNLIVVNP 82

Query: 337 DTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDLI 489
           DTSPRGV+I G D ++DFG  AGFY+DA  EPW+ +Y+M SY+  EL D++
Sbjct: 83  DTSPRGVEIAGQDDAYDFGSGAGFYVDAKEEPWSKHYKMYSYVTQELVDVV 133



 Score = 93.5 bits (222), Expect = 3e-19
 Identities = 39/68 (57%), Positives = 48/68 (70%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGP 740
           AL+  L+NPG Y+SVSAFA I NP+ CPWG KAF+GYLG +   WA WDAT LV +Y   
Sbjct: 156 ALICALKNPGLYQSVSAFAPIANPTECPWGKKAFAGYLGSNPDDWALWDATHLVSQYEST 215

Query: 741 PLTLLLDR 764
           P  L +D+
Sbjct: 216 PQELFIDQ 223



 Score = 54.8 bits (126), Expect = 1e-07
 Identities = 26/54 (48%), Positives = 35/54 (64%)
 Frame = +2

Query: 92  SLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           +L+  S+NK F G Q+VY H S  LKC M F ++LPP A  G    P+L++LSG
Sbjct: 2   TLEQLSANKCFEGEQRVYRHRSDTLKCDMTFGVFLPPAALEGK-PCPVLFFLSG 54


>AE014297-2760|AAN13821.2|  330|Drosophila melanogaster CG4390-PB,
           isoform B protein.
          Length = 330

 Score =  111 bits (267), Expect = 1e-24
 Identities = 54/111 (48%), Positives = 72/111 (64%), Gaps = 2/111 (1%)
 Frame = +1

Query: 163 IKMQNEFFYLSPPSGRRG*CEITTSILFVWS--TCSEQNFITKSGFQRYAAEHGVIVVGP 336
           +K    F    PP+   G       +LF  S  TC+ +NFI KSGFQ++AA H +IVV P
Sbjct: 70  LKCDMTFGVFLPPAALEG---KPCPVLFFLSGLTCTHENFIQKSGFQQHAARHNLIVVNP 126

Query: 337 DTSPRGVKIDGDDSSWDFGVSAGFYLDATNEPWNNNYRMGSYLNVELYDLI 489
           DTSPRGV+I G D ++DFG  AGFY+DA  EPW+ +Y+M SY+  EL D++
Sbjct: 127 DTSPRGVEIAGQDDAYDFGSGAGFYVDAKEEPWSKHYKMYSYVTQELVDVV 177



 Score = 93.5 bits (222), Expect = 3e-19
 Identities = 39/68 (57%), Positives = 48/68 (70%)
 Frame = +3

Query: 561 ALVSTLRNPGQYKSVSAFAAICNPSACPWGVKAFSGYLGEDKSKWAEWDATELVKKYNGP 740
           AL+  L+NPG Y+SVSAFA I NP+ CPWG KAF+GYLG +   WA WDAT LV +Y   
Sbjct: 200 ALICALKNPGLYQSVSAFAPIANPTECPWGKKAFAGYLGSNPDDWALWDATHLVSQYEST 259

Query: 741 PLTLLLDR 764
           P  L +D+
Sbjct: 260 PQELFIDQ 267



 Score = 55.2 bits (127), Expect = 9e-08
 Identities = 29/57 (50%), Positives = 36/57 (63%)
 Frame = +2

Query: 83  NMDSLQLESSNKIFGGYQKVYSHASSELKCKMNFSIYLPPQAEGGDVKLPLLYYLSG 253
           NM   QL S+NK F G Q+VY H S  LKC M F ++LPP A  G    P+L++LSG
Sbjct: 44  NMTLEQL-SANKCFEGEQRVYRHRSDTLKCDMTFGVFLPPAALEGK-PCPVLFFLSG 98


>AY051575-1|AAK92999.1|  560|Drosophila melanogaster GH22314p
           protein.
          Length = 560

 Score = 29.9 bits (64), Expect = 4.0
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%)
 Frame = -1

Query: 260 QVDQTNNIEVVIS-HHPLLPEGGDR*KNSFCILIQMMHENTLFDNHQKFYWTILI 99
           Q  QT  + V +   HPLL  GGD  ++ +      + + + F+  +KF + IL+
Sbjct: 428 QQQQTTQLPVQLQLQHPLLQTGGDGKQSVYAPPTVQLRKQSRFNARKKFQFAILV 482


>U73846-1|AAB61993.1|  808|Drosophila melanogaster testis-specific
           RNP-type RNA bindingprotein protein.
          Length = 808

 Score = 28.7 bits (61), Expect = 9.3
 Identities = 15/36 (41%), Positives = 21/36 (58%)
 Frame = -2

Query: 409 KNRH*LQNPMMNHLHQS*LHVAKYQDLRQLHHVRLH 302
           K+ H LQ+   +H HQ   H A +Q  +QLHH + H
Sbjct: 95  KSSHSLQHHHSHH-HQLQRHTALHQQQQQLHHHQPH 129


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 36,530,816
Number of Sequences: 53049
Number of extensions: 800856
Number of successful extensions: 1797
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 1692
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1797
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3561257073
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -