SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120020.Seq
         (726 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF228055-1|AAG43052.1|  142|Drosophila melanogaster adaptor prot...    29   8.5  

>AF228055-1|AAG43052.1|  142|Drosophila melanogaster adaptor protein
           complex AP-2 smallchain sigma2 protein.
          Length = 142

 Score = 28.7 bits (61), Expect = 8.5
 Identities = 18/63 (28%), Positives = 26/63 (41%)
 Frame = +3

Query: 387 GGASASLRENVNNQLHARDASQLHLLDWENFMGEFSSYFGLTHTTCSISNI*QLTYLLNK 566
           G     L E V+  +  RDA     +++ NF   +  Y GL    C   N   L YL   
Sbjct: 25  GDEKQKLIEEVHAVVTVRDAKHTSFVEFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAI 84

Query: 567 HSY 575
           H++
Sbjct: 85  HNF 87


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 29,660,002
Number of Sequences: 53049
Number of extensions: 591474
Number of successful extensions: 1433
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1378
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1433
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3252477558
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -