SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120019.Seq
         (804 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L49440-1|AAC41609.1|  438|Drosophila melanogaster apoptosis 1 in...    66   5e-11
AE014296-2621|AAN11757.1|  438|Drosophila melanogaster CG12284-P...    66   5e-11
AE014296-2620|AAG22319.1|  438|Drosophila melanogaster CG12284-P...    66   5e-11
AE014296-2619|AAF49548.1|  438|Drosophila melanogaster CG12284-P...    66   5e-11
U32373-1|AAC47155.1|  497|Drosophila melanogaster IAP-like prote...    63   5e-10
U45881-1|AAC46988.1|  498|Drosophila melanogaster inhibitor of a...    62   7e-10
L49441-1|AAC41610.1|  498|Drosophila melanogaster apoptosis 2 in...    62   7e-10
AY051844-1|AAK93268.1|  498|Drosophila melanogaster LD34777p pro...    62   7e-10
AE013599-2132|AAO41389.1|  498|Drosophila melanogaster CG8293-PB...    62   7e-10
AE013599-2131|AAF58095.1|  498|Drosophila melanogaster CG8293-PA...    62   7e-10
U38809-1|AAB08398.1|  482|Drosophila melanogaster DIHA protein.        61   2e-09
AY071487-1|AAL49109.1|  153|Drosophila melanogaster RE55472p pro...    46   5e-05
AE014297-2329|AAF55399.1|  153|Drosophila melanogaster CG12265-P...    46   5e-05
AY119104-1|AAM50964.1| 1151|Drosophila melanogaster RE07981p pro...    40   0.004
AF517634-1|AAM77747.1| 4876|Drosophila melanogaster BIR-containi...    40   0.004
AE014297-1135|AAF54520.3| 4876|Drosophila melanogaster CG6303-PA...    40   0.004
AE014296-2526|ABC66138.1|  277|Drosophila melanogaster CG33985-P...    30   3.2  
AY113389-1|AAM29394.1|  343|Drosophila melanogaster RE06383p pro...    29   5.6  
AE014296-2569|AAF49585.2|  343|Drosophila melanogaster CG7554-PA...    29   5.6  
AE014296-3135|AAO41228.1|  407|Drosophila melanogaster CG9614-PG...    29   9.8  

>L49440-1|AAC41609.1|  438|Drosophila melanogaster apoptosis 1
           inhibitor protein.
          Length = 438

 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 28/64 (43%), Positives = 38/64 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L+     +AEAG FYTG GD   CF C   + DW+ N++ W++HA    QC FV  
Sbjct: 236 WPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKL 295

Query: 695 VKGK 706
           +KG+
Sbjct: 296 MKGQ 299



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           WP    D    +A+ G+++T  GD+  CFFC   +  W   +     H   +P C
Sbjct: 54  WPLDWLDK-RQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNC 107


>AE014296-2621|AAN11757.1|  438|Drosophila melanogaster CG12284-PC,
           isoform C protein.
          Length = 438

 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 28/64 (43%), Positives = 38/64 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L+     +AEAG FYTG GD   CF C   + DW+ N++ W++HA    QC FV  
Sbjct: 236 WPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKL 295

Query: 695 VKGK 706
           +KG+
Sbjct: 296 MKGQ 299



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           WP    D    +A+ G+++T  GD+  CFFC   +  W   +     H   +P C
Sbjct: 54  WPLDWLDK-RQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNC 107


>AE014296-2620|AAG22319.1|  438|Drosophila melanogaster CG12284-PB,
           isoform B protein.
          Length = 438

 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 28/64 (43%), Positives = 38/64 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L+     +AEAG FYTG GD   CF C   + DW+ N++ W++HA    QC FV  
Sbjct: 236 WPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKL 295

Query: 695 VKGK 706
           +KG+
Sbjct: 296 MKGQ 299



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           WP    D    +A+ G+++T  GD+  CFFC   +  W   +     H   +P C
Sbjct: 54  WPLDWLDK-RQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNC 107


>AE014296-2619|AAF49548.1|  438|Drosophila melanogaster CG12284-PA,
           isoform A protein.
          Length = 438

 Score = 66.1 bits (154), Expect = 5e-11
 Identities = 28/64 (43%), Positives = 38/64 (59%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP  L+     +AEAG FYTG GD   CF C   + DW+ N++ W++HA    QC FV  
Sbjct: 236 WPRNLKQKPHQLAEAGFFYTGVGDRVRCFSCGGGLMDWNDNDEPWEQHALWLSQCRFVKL 295

Query: 695 VKGK 706
           +KG+
Sbjct: 296 MKGQ 299



 Score = 38.7 bits (86), Expect = 0.009
 Identities = 16/55 (29%), Positives = 25/55 (45%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQC 679
           WP    D    +A+ G+++T  GD+  CFFC   +  W   +     H   +P C
Sbjct: 54  WPLDWLDK-RQLAQTGMYFTHAGDKVKCFFCGVEIGCWEQEDQPVPEHQRWSPNC 107


>U32373-1|AAC47155.1|  497|Drosophila melanogaster IAP-like protein
           ILP protein.
          Length = 497

 Score = 62.9 bits (146), Expect = 5e-10
 Identities = 25/74 (33%), Positives = 39/74 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +     + +A+AGL+Y   GD+  CF C+  +R W   ++ W  HA  +P+C FVL 
Sbjct: 222 WPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLL 281

Query: 695 VKGKEFCQNAITAT 736
            KG  +    +  T
Sbjct: 282 AKGPSYVSEVLATT 295



 Score = 34.3 bits (75), Expect = 0.20
 Identities = 17/59 (28%), Positives = 24/59 (40%)
 Frame = +2

Query: 518 PAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           P +  D++ N    G F TG   E  C FC   +  W   +     H   +P C  VL+
Sbjct: 24  PVSAEDLVAN----GFFATGNWLEAECHFCHVRIDRWEYGDQVAAGHRRSSPICSMVLA 78



 Score = 31.9 bits (69), Expect = 1.1
 Identities = 10/39 (25%), Positives = 21/39 (53%)
 Frame = +3

Query: 261 YNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 240 YQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 28.7 bits (61), Expect = 9.8
 Identities = 14/46 (30%), Positives = 19/46 (41%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 371
           Q L +  F Y    DHV C +C   I  W +++     H    P C
Sbjct: 131 QALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


>U45881-1|AAC46988.1|  498|Drosophila melanogaster inhibitor of
           apoptosis protein protein.
          Length = 498

 Score = 62.5 bits (145), Expect = 7e-10
 Identities = 25/74 (33%), Positives = 39/74 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +     + +A+AGL+Y   GD+  CF C+  +R W   ++ W  HA  +P+C FVL 
Sbjct: 222 WPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLL 281

Query: 695 VKGKEFCQNAITAT 736
            KG  +    +  T
Sbjct: 282 AKGPAYVSEVLATT 295



 Score = 39.1 bits (87), Expect = 0.007
 Identities = 18/59 (30%), Positives = 27/59 (45%)
 Frame = +2

Query: 518 PAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           P +  D++ N    G F TG+  E  C FC   +  W   +   +RH   +P C  VL+
Sbjct: 24  PVSAEDLVAN----GFFATGKWLEAECHFCHVRIDRWEYGDQVAERHRRSSPICSMVLA 78



 Score = 31.9 bits (69), Expect = 1.1
 Identities = 10/39 (25%), Positives = 21/39 (53%)
 Frame = +3

Query: 261 YNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 240 YQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 28.7 bits (61), Expect = 9.8
 Identities = 14/46 (30%), Positives = 19/46 (41%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 371
           Q L +  F Y    DHV C +C   I  W +++     H    P C
Sbjct: 131 QALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


>L49441-1|AAC41610.1|  498|Drosophila melanogaster apoptosis 2
           inhibitor protein.
          Length = 498

 Score = 62.5 bits (145), Expect = 7e-10
 Identities = 25/74 (33%), Positives = 39/74 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +     + +A+AGL+Y   GD+  CF C+  +R W   ++ W  HA  +P+C FVL 
Sbjct: 222 WPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLL 281

Query: 695 VKGKEFCQNAITAT 736
            KG  +    +  T
Sbjct: 282 AKGPAYVSEVLATT 295



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 18/59 (30%), Positives = 26/59 (44%)
 Frame = +2

Query: 518 PAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           P +  D++ N    G F TG   E  C FC   +  W   +   +RH   +P C  VL+
Sbjct: 24  PVSAEDLVAN----GFFATGNWLEAECHFCHVRIDRWEYGDQVAERHRRSSPICSMVLA 78



 Score = 31.9 bits (69), Expect = 1.1
 Identities = 10/39 (25%), Positives = 21/39 (53%)
 Frame = +3

Query: 261 YNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 240 YQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 28.7 bits (61), Expect = 9.8
 Identities = 14/46 (30%), Positives = 19/46 (41%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 371
           Q L +  F Y    DHV C +C   I  W +++     H    P C
Sbjct: 131 QALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


>AY051844-1|AAK93268.1|  498|Drosophila melanogaster LD34777p
           protein.
          Length = 498

 Score = 62.5 bits (145), Expect = 7e-10
 Identities = 25/74 (33%), Positives = 39/74 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +     + +A+AGL+Y   GD+  CF C+  +R W   ++ W  HA  +P+C FVL 
Sbjct: 222 WPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLL 281

Query: 695 VKGKEFCQNAITAT 736
            KG  +    +  T
Sbjct: 282 AKGPAYVSEVLATT 295



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 18/59 (30%), Positives = 26/59 (44%)
 Frame = +2

Query: 518 PAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           P +  D++ N    G F TG   E  C FC   +  W   +   +RH   +P C  VL+
Sbjct: 24  PVSAEDLVAN----GFFATGNWLEAECHFCHVRIDRWEYGDQVAERHRRSSPICSMVLA 78



 Score = 31.9 bits (69), Expect = 1.1
 Identities = 10/39 (25%), Positives = 21/39 (53%)
 Frame = +3

Query: 261 YNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 240 YQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 28.7 bits (61), Expect = 9.8
 Identities = 14/46 (30%), Positives = 19/46 (41%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 371
           Q L +  F Y    DHV C +C   I  W +++     H    P C
Sbjct: 131 QALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


>AE013599-2132|AAO41389.1|  498|Drosophila melanogaster CG8293-PB,
           isoform B protein.
          Length = 498

 Score = 62.5 bits (145), Expect = 7e-10
 Identities = 25/74 (33%), Positives = 39/74 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +     + +A+AGL+Y   GD+  CF C+  +R W   ++ W  HA  +P+C FVL 
Sbjct: 222 WPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLL 281

Query: 695 VKGKEFCQNAITAT 736
            KG  +    +  T
Sbjct: 282 AKGPAYVSEVLATT 295



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 18/59 (30%), Positives = 26/59 (44%)
 Frame = +2

Query: 518 PAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           P +  D++ N    G F TG   E  C FC   +  W   +   +RH   +P C  VL+
Sbjct: 24  PVSAEDLVAN----GFFATGNWLEAECHFCHVRIDRWEYGDQVAERHRRSSPICSMVLA 78



 Score = 31.9 bits (69), Expect = 1.1
 Identities = 10/39 (25%), Positives = 21/39 (53%)
 Frame = +3

Query: 261 YNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 240 YQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 28.7 bits (61), Expect = 9.8
 Identities = 14/46 (30%), Positives = 19/46 (41%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 371
           Q L +  F Y    DHV C +C   I  W +++     H    P C
Sbjct: 131 QALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


>AE013599-2131|AAF58095.1|  498|Drosophila melanogaster CG8293-PA,
           isoform A protein.
          Length = 498

 Score = 62.5 bits (145), Expect = 7e-10
 Identities = 25/74 (33%), Positives = 39/74 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +     + +A+AGL+Y   GD+  CF C+  +R W   ++ W  HA  +P+C FVL 
Sbjct: 222 WPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLL 281

Query: 695 VKGKEFCQNAITAT 736
            KG  +    +  T
Sbjct: 282 AKGPAYVSEVLATT 295



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 18/59 (30%), Positives = 26/59 (44%)
 Frame = +2

Query: 518 PAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           P +  D++ N    G F TG   E  C FC   +  W   +   +RH   +P C  VL+
Sbjct: 24  PVSAEDLVAN----GFFATGNWLEAECHFCHVRIDRWEYGDQVAERHRRSSPICSMVLA 78



 Score = 31.9 bits (69), Expect = 1.1
 Identities = 10/39 (25%), Positives = 21/39 (53%)
 Frame = +3

Query: 261 YNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 240 YQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 278



 Score = 28.7 bits (61), Expect = 9.8
 Identities = 14/46 (30%), Positives = 19/46 (41%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 371
           Q L +  F Y    DHV C +C   I  W +++     H    P C
Sbjct: 131 QALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 176


>U38809-1|AAB08398.1|  482|Drosophila melanogaster DIHA protein.
          Length = 482

 Score = 61.3 bits (142), Expect = 2e-09
 Identities = 25/74 (33%), Positives = 39/74 (52%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           WP +     + +A+AGL+Y   GD+  CF C+  +R W   ++ W  HA  +P+C FVL 
Sbjct: 206 WPISNIQPASALAQAGLYYQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQFVLL 265

Query: 695 VKGKEFCQNAITAT 736
            KG  +    +  T
Sbjct: 266 DKGPAYVSEVLATT 279



 Score = 38.3 bits (85), Expect = 0.012
 Identities = 18/59 (30%), Positives = 26/59 (44%)
 Frame = +2

Query: 518 PAALRDMITNIAEAGLFYTGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLS 694
           P +  D++ N    G F TG   E  C FC   +  W   +   +RH   +P C  VL+
Sbjct: 8   PVSAEDLVAN----GFFATGNWLEAECHFCHVRIDRWEYGDQVAERHRRSSPICSMVLA 62



 Score = 31.9 bits (69), Expect = 1.1
 Identities = 10/39 (25%), Positives = 21/39 (53%)
 Frame = +3

Query: 261 YNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYCAY 377
           Y ++ D V C +C   +++W +++   + H   SP C +
Sbjct: 224 YQKIGDQVRCFHCNIGLRSWQKEDEPWFEHAKWSPKCQF 262



 Score = 28.7 bits (61), Expect = 9.8
 Identities = 14/46 (30%), Positives = 19/46 (41%)
 Frame = +3

Query: 234 QQLDR*RFKYNQVDDHVVCEYCEAEIKNWSEDECIEYAHVTLSPYC 371
           Q L +  F Y    DHV C +C   I  W +++     H    P C
Sbjct: 115 QALAKAGFYYLNRLDHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQC 160


>AY071487-1|AAL49109.1|  153|Drosophila melanogaster RE55472p
           protein.
          Length = 153

 Score = 46.4 bits (105), Expect = 5e-05
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 3/60 (5%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTG---RGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           +P      I+ +AEAG ++TG     D   CF C   +  W   +D W+ H    PQC F
Sbjct: 40  FPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAPQCEF 99


>AE014297-2329|AAF55399.1|  153|Drosophila melanogaster CG12265-PA
           protein.
          Length = 153

 Score = 46.4 bits (105), Expect = 5e-05
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 3/60 (5%)
 Frame = +2

Query: 515 WPAALRDMITNIAEAGLFYTG---RGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYF 685
           +P      I+ +AEAG ++TG     D   CF C   +  W   +D W+ H    PQC F
Sbjct: 40  FPETASCSISKMAEAGFYWTGTKRENDTATCFVCGKTLDGWEPEDDPWKEHVKHAPQCEF 99


>AY119104-1|AAM50964.1| 1151|Drosophila melanogaster RE07981p
           protein.
          Length = 1151

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +2

Query: 548 IAEAGLFY---TGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQ 718
           +A+AG ++   +   D  +CF C  C+  W   ++ W  H   +P C F   VKG E+ Q
Sbjct: 271 MAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERHSPLCPF---VKG-EYTQ 326

Query: 719 N 721
           N
Sbjct: 327 N 327


>AF517634-1|AAM77747.1| 4876|Drosophila melanogaster BIR-containing
           ubiquitin-conjugatingenzyme protein.
          Length = 4876

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +2

Query: 548 IAEAGLFY---TGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQ 718
           +A+AG ++   +   D  +CF C  C+  W   ++ W  H   +P C F   VKG E+ Q
Sbjct: 271 MAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERHSPLCPF---VKG-EYTQ 326

Query: 719 N 721
           N
Sbjct: 327 N 327


>AE014297-1135|AAF54520.3| 4876|Drosophila melanogaster CG6303-PA
           protein.
          Length = 4876

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 3/61 (4%)
 Frame = +2

Query: 548 IAEAGLFY---TGRGDETVCFFCDCCVRDWHINEDAWQRHATENPQCYFVLSVKGKEFCQ 718
           +A+AG ++   +   D  +CF C  C+  W   ++ W  H   +P C F   VKG E+ Q
Sbjct: 271 MAQAGFYHQPSSSGEDRAMCFTCSVCLVCWEKTDEPWSEHERHSPLCPF---VKG-EYTQ 326

Query: 719 N 721
           N
Sbjct: 327 N 327


>AE014296-2526|ABC66138.1|  277|Drosophila melanogaster CG33985-PA
           protein.
          Length = 277

 Score = 30.3 bits (65), Expect = 3.2
 Identities = 26/100 (26%), Positives = 45/100 (45%)
 Frame = -3

Query: 622 TYATIAKETYSFVSATRVKKSRFRNVRNHVTQCGRPKITNVSIRDCKLDMHLYTHLGLPS 443
           T  T    T S V  T +  S    +R  V Q G    T+VS     +++ + T++  P 
Sbjct: 97  TEITSESSTISTVVITTLAPSAVVTLRPSVNQSGASSTTSVSPA---IEI-IVTNV-CPQ 151

Query: 442 FTSTALMVMLSPNDSCSAILLAYAQYGDKVTCAYSIHSSS 323
             + + + +L   +SCS   + Y      ++CA S+H +S
Sbjct: 152 LDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNS 191


>AY113389-1|AAM29394.1|  343|Drosophila melanogaster RE06383p
           protein.
          Length = 343

 Score = 29.5 bits (63), Expect = 5.6
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = -3

Query: 574 RVKKSRFRNVRNHVTQCGRPKITNVSIR-DCKLDMHLYTHL-GLPSFTSTALMVMLSPND 401
           R  K  +RN  N  TQC    I  + +  D +  +  YT + GLPS+ +   ++  SP  
Sbjct: 148 RTWKRNYRNNANGSTQCTIVDIEALKLHPDVEDPVPEYTLVSGLPSYEAALELLQKSPQS 207

Query: 400 SC 395
           SC
Sbjct: 208 SC 209


>AE014296-2569|AAF49585.2|  343|Drosophila melanogaster CG7554-PA
           protein.
          Length = 343

 Score = 29.5 bits (63), Expect = 5.6
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 2/62 (3%)
 Frame = -3

Query: 574 RVKKSRFRNVRNHVTQCGRPKITNVSIR-DCKLDMHLYTHL-GLPSFTSTALMVMLSPND 401
           R  K  +RN  N  TQC    I  + +  D +  +  YT + GLPS+ +   ++  SP  
Sbjct: 148 RTWKRNYRNNANGSTQCTIVDIEALKLHPDVEDPVPEYTLVSGLPSYEAALELLQKSPQS 207

Query: 400 SC 395
           SC
Sbjct: 208 SC 209


>AE014296-3135|AAO41228.1|  407|Drosophila melanogaster CG9614-PG,
           isoform G protein.
          Length = 407

 Score = 28.7 bits (61), Expect = 9.8
 Identities = 11/32 (34%), Positives = 16/32 (50%)
 Frame = +2

Query: 506 CNFWPAALRDMITNIAEAGLFYTGRGDETVCF 601
           C + P  ++D I N     LFY G  D+ + F
Sbjct: 264 CQYVPHTVKDSIANFKRQSLFYCGHHDDCLPF 295


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 33,809,356
Number of Sequences: 53049
Number of extensions: 731974
Number of successful extensions: 2415
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 2296
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2413
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3757402116
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -