SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120018.Seq
         (789 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BT015973-1|AAV36858.1|  835|Drosophila melanogaster RE74565p pro...    73   6e-13
AY118417-1|AAM48446.1|  835|Drosophila melanogaster RE70645p pro...    73   6e-13
AE014297-673|AAF54167.1| 1061|Drosophila melanogaster CG2684-PA ...    73   6e-13
X62629-1|CAA44496.1|  974|Drosophila melanogaster lodestar prote...    69   7e-12
BT022847-1|AAY55263.1|  726|Drosophila melanogaster IP13006p pro...    65   9e-11
AE014297-672|AAF54166.1|  965|Drosophila melanogaster CG10445-PA...    65   9e-11
Y10229-1|CAA71278.1|  784|Drosophila melanogaster RAD54 protein.       51   2e-06
AY069599-1|AAL39744.2|  788|Drosophila melanogaster LD35220p pro...    51   2e-06
AF069780-1|AAC26857.1|  628|Drosophila melanogaster RAD54 DNA re...    51   2e-06
AF069779-1|AAC24577.1|  784|Drosophila melanogaster Rad54 homolo...    51   2e-06
AE014134-530|AAF51168.1|  784|Drosophila melanogaster CG3736-PA ...    51   2e-06
AF007780-1|AAB87384.1| 1518|Drosophila melanogaster CHD3 protein.      45   1e-04
AE014296-3147|AAF49162.2|  892|Drosophila melanogaster CG9594-PA...    44   2e-04
AY058653-1|AAL13882.1| 1207|Drosophila melanogaster LD35434p pro...    42   0.001
AY051813-1|AAK93237.1| 1095|Drosophila melanogaster LD32234p pro...    42   0.001
AF254373-1|AAK53539.1| 2497|Drosophila melanogaster DOMINO B pro...    42   0.001
AF076776-1|AAF82185.1| 3201|Drosophila melanogaster helicase DOM...    42   0.001
AE013599-3190|AAM70872.2| 2497|Drosophila melanogaster CG9696-PE...    42   0.001
AE013599-3189|AAM70871.1| 3198|Drosophila melanogaster CG9696-PA...    42   0.001
AE013599-3188|AAM70870.1| 3183|Drosophila melanogaster CG9696-PD...    42   0.001
M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein...    41   0.002
BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p pro...    41   0.002
AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p pro...    41   0.002
AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB...    41   0.002
AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA...    41   0.002
AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD...    41   0.002
AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC...    41   0.002
AY071503-1|AAL49125.1|  627|Drosophila melanogaster RE55932p pro...    40   0.003
L77907-1|AAC37264.1| 1883|Drosophila melanogaster chromodomain-h...    40   0.004
BT011071-1|AAR82736.1| 1645|Drosophila melanogaster SD21488p pro...    40   0.004
AY095050-1|AAM11378.1| 1101|Drosophila melanogaster LD39323p pro...    40   0.004
AF215703-1|AAF43004.1| 5322|Drosophila melanogaster KISMET-L lon...    40   0.004
AE014134-528|AAF51170.1| 1883|Drosophila melanogaster CG3733-PA ...    40   0.004
AE014134-62|AAF51527.3| 5322|Drosophila melanogaster CG3696-PA, ...    40   0.004
L27127-1|AAA19868.1| 1027|Drosophila melanogaster ISWI protein p...    39   0.007
AY094908-1|AAM11261.1| 1027|Drosophila melanogaster RH13158p pro...    39   0.007
AF119716-1|AAD17276.1| 1982|Drosophila melanogaster dMi-2 protei...    39   0.007
AE014296-3240|AAX52739.1| 1983|Drosophila melanogaster CG8103-PB...    39   0.007
AE014296-3239|AAF49099.2| 1982|Drosophila melanogaster CG8103-PA...    39   0.007
AE013599-1548|AAM68638.1| 1027|Drosophila melanogaster CG8625-PC...    39   0.007
AE013599-1547|AAM68637.1| 1027|Drosophila melanogaster CG8625-PB...    39   0.007
AE013599-1546|AAF58479.1| 1027|Drosophila melanogaster CG8625-PA...    39   0.007
AE014134-1718|ABC65886.1|  831|Drosophila melanogaster CG5899-PC...    39   0.009
AE014134-1717|AAF52824.1|  844|Drosophila melanogaster CG5899-PA...    39   0.009
AY069822-1|AAL39967.1|  655|Drosophila melanogaster SD07188p pro...    37   0.027
AY058592-1|AAL13821.1| 1311|Drosophila melanogaster LD28477p pro...    37   0.027
AF217802-1|AAG40586.1| 1311|Drosophila melanogaster xnp/atr-x DN...    37   0.027
AE014297-3805|AAN14055.1| 1311|Drosophila melanogaster CG4548-PB...    37   0.027
AE014297-3804|AAF56471.1| 1311|Drosophila melanogaster CG4548-PA...    37   0.027
AY069786-1|AAL39931.1| 1638|Drosophila melanogaster SD02886p pro...    35   0.11 
AE014297-2651|AAF55658.2| 1638|Drosophila melanogaster CG31212-P...    35   0.11 
BT003614-1|AAO39617.1| 1221|Drosophila melanogaster GH12153p pro...    31   1.4  
BT001892-1|AAN71681.1|  673|Drosophila melanogaster SD16865p pro...    31   1.4  
AF033104-1|AAB95091.3| 1924|Drosophila melanogaster 89B helicase...    31   1.4  
AE014297-2129|AAF55260.2| 1929|Drosophila melanogaster CG4261-PA...    31   1.4  
AE013599-3816|AAF47165.3| 1669|Drosophila melanogaster CG4049-PA...    30   3.1  
U59923-1|AAC47469.1| 1714|Drosophila melanogaster glutamyl-proly...    29   7.2  
M74104-1|AAA28594.1| 1714|Drosophila melanogaster transfer RNA-G...    29   7.2  
BT001645-1|AAN71400.1|  998|Drosophila melanogaster RE41560p pro...    29   7.2  
AY665384-1|AAT76551.1|  514|Drosophila melanogaster CG4928 protein.    29   7.2  
AY058703-1|AAL13932.1| 1714|Drosophila melanogaster LD42739p pro...    29   7.2  
AF145657-1|AAD38632.1|  538|Drosophila melanogaster BcDNA.GH1012...    29   7.2  
AE014298-2503|AAF48682.1|  538|Drosophila melanogaster CG4928-PB...    29   7.2  
AE014298-2502|AAN09429.1|  538|Drosophila melanogaster CG4928-PA...    29   7.2  
AE014297-3421|AAN13964.1|  996|Drosophila melanogaster CG5394-PB...    29   7.2  
AE014297-3420|AAF56211.1| 1714|Drosophila melanogaster CG5394-PA...    29   7.2  

>BT015973-1|AAV36858.1|  835|Drosophila melanogaster RE74565p
           protein.
          Length = 835

 Score = 72.5 bits (170), Expect = 6e-13
 Identities = 39/86 (45%), Positives = 51/86 (59%)
 Frame = +1

Query: 511 LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
           L   IL +SDDK I+VSQW   L I  +   +  +ATL   G + V++R      FN+  
Sbjct: 673 LKTSILKSSDDKAIVVSQWTSVLDILRDHLSKDGVATLSLNGTIPVKNRQDIVNEFND-R 731

Query: 691 DTQHRILLLSIKCGGVGLNLIGGNTL 768
           + Q R+LLLS+  GGVGLNLIG N L
Sbjct: 732 NNQKRVLLLSLTAGGVGLNLIGANHL 757



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 30/90 (33%), Positives = 56/90 (62%), Gaps = 7/90 (7%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKKIVLKR 194
           RW +TGTPI NK  D+Y+++ FL+C PF+D   WK  + NK+    NR+  ++K ++L+R
Sbjct: 401 RWALTGTPIQNKELDVYALLKFLRCSPFDDLHTWKKWIDNKSAGGQNRLNLLMKSLMLRR 460

Query: 195 DKSEISF-----NIPKHTVEYVHVNLMKKK 269
            K+++       ++P   +  + ++L K++
Sbjct: 461 TKAQLQSDGKLNSLPNKELRLIEISLDKEE 490



 Score = 33.5 bits (73), Expect = 0.34
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQH-VLWLILKLRQICCHPYL 427
           ++  K  Y+++K +   AY K +  + +    S+ +   H +L L+L+LRQICCHP L
Sbjct: 523 SDANKPTYNQIK-DPNGAYYK-MHEKFARMAGSKKEVKSHDILVLLLRLRQICCHPGL 578


>AY118417-1|AAM48446.1|  835|Drosophila melanogaster RE70645p
           protein.
          Length = 835

 Score = 72.5 bits (170), Expect = 6e-13
 Identities = 39/86 (45%), Positives = 51/86 (59%)
 Frame = +1

Query: 511 LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
           L   IL +SDDK I+VSQW   L I  +   +  +ATL   G + V++R      FN+  
Sbjct: 673 LKTSILKSSDDKAIVVSQWTSVLDILRDHLSKDGVATLSLNGTIPVKNRQDIVNEFND-R 731

Query: 691 DTQHRILLLSIKCGGVGLNLIGGNTL 768
           + Q R+LLLS+  GGVGLNLIG N L
Sbjct: 732 NNQKRVLLLSLTAGGVGLNLIGANHL 757



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 30/90 (33%), Positives = 56/90 (62%), Gaps = 7/90 (7%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKKIVLKR 194
           RW +TGTPI NK  D+Y+++ FL+C PF+D   WK  + NK+    NR+  ++K ++L+R
Sbjct: 401 RWALTGTPIQNKELDVYALLKFLRCSPFDDLHTWKKWIDNKSAGGQNRLNLLMKSLMLRR 460

Query: 195 DKSEISF-----NIPKHTVEYVHVNLMKKK 269
            K+++       ++P   +  + ++L K++
Sbjct: 461 TKAQLQSDGKLNSLPNKELRLIEISLDKEE 490



 Score = 33.5 bits (73), Expect = 0.34
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQH-VLWLILKLRQICCHPYL 427
           ++  K  Y+++K +   AY K +  + +    S+ +   H +L L+L+LRQICCHP L
Sbjct: 523 SDANKPTYNQIK-DPNGAYYK-MHEKFARMAGSKKEVKSHDILVLLLRLRQICCHPGL 578


>AE014297-673|AAF54167.1| 1061|Drosophila melanogaster CG2684-PA
            protein.
          Length = 1061

 Score = 72.5 bits (170), Expect = 6e-13
 Identities = 39/86 (45%), Positives = 51/86 (59%)
 Frame = +1

Query: 511  LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAA 690
            L   IL +SDDK I+VSQW   L I  +   +  +ATL   G + V++R      FN+  
Sbjct: 899  LKTSILKSSDDKAIVVSQWTSVLDILRDHLSKDGVATLSLNGTIPVKNRQDIVNEFND-R 957

Query: 691  DTQHRILLLSIKCGGVGLNLIGGNTL 768
            + Q R+LLLS+  GGVGLNLIG N L
Sbjct: 958  NNQKRVLLLSLTAGGVGLNLIGANHL 983



 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 30/90 (33%), Positives = 56/90 (62%), Gaps = 7/90 (7%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKKIVLKR 194
           RW +TGTPI NK  D+Y+++ FL+C PF+D   WK  + NK+    NR+  ++K ++L+R
Sbjct: 627 RWALTGTPIQNKELDVYALLKFLRCSPFDDLHTWKKWIDNKSAGGQNRLNLLMKSLMLRR 686

Query: 195 DKSEISF-----NIPKHTVEYVHVNLMKKK 269
            K+++       ++P   +  + ++L K++
Sbjct: 687 TKAQLQSDGKLNSLPNKELRLIEISLDKEE 716



 Score = 33.5 bits (73), Expect = 0.34
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQH-VLWLILKLRQICCHPYL 427
           ++  K  Y+++K +   AY K +  + +    S+ +   H +L L+L+LRQICCHP L
Sbjct: 749 SDANKPTYNQIK-DPNGAYYK-MHEKFARMAGSKKEVKSHDILVLLLRLRQICCHPGL 804


>X62629-1|CAA44496.1|  974|Drosophila melanogaster lodestar protein
           protein.
          Length = 974

 Score = 68.9 bits (161), Expect = 7e-12
 Identities = 30/90 (33%), Positives = 56/90 (62%), Gaps = 7/90 (7%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK--MLNKNNDSTNRIKSIIKKIVLKR 194
           RW +TGTPI NK  D+Y+++ FL+C PF+D   WK  + NK+    NR+  ++K ++L+R
Sbjct: 627 RWALTGTPIQNKELDVYALLKFLRCSPFDDLHTWKKWIDNKSAGGQNRLNLLMKSLMLRR 686

Query: 195 DKSEISF-----NIPKHTVEYVHVNLMKKK 269
            K+++       ++P   +  + ++L K++
Sbjct: 687 TKAQLQSDGKLNSLPNKELRLIEISLDKEE 716



 Score = 42.7 bits (96), Expect = 5e-04
 Identities = 20/49 (40%), Positives = 28/49 (57%)
 Frame = +1

Query: 511  LVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDR 657
            L   IL +SDDK I+VSQW   L I  +   +  +ATL   G + V++R
Sbjct: 899  LKTSILKSSDDKAIVVSQWTSVLDILRDHLSKDGVATLSLNGTIPVKNR 947



 Score = 33.5 bits (73), Expect = 0.34
 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = +2

Query: 257 NEEEKTLYDKLKCESEEAYMKAVAARESENTLSRLQQMQH-VLWLILKLRQICCHPYL 427
           ++  K  Y+++K +   AY K +  + +    S+ +   H +L L+L+LRQICCHP L
Sbjct: 749 SDANKPTYNQIK-DPNGAYYK-MHEKFARMAGSKKEVKSHDILVLLLRLRQICCHPGL 804


>BT022847-1|AAY55263.1|  726|Drosophila melanogaster IP13006p
           protein.
          Length = 726

 Score = 65.3 bits (152), Expect = 9e-11
 Identities = 33/79 (41%), Positives = 50/79 (63%)
 Frame = +1

Query: 514 VDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
           ++++L  ++DKII+ SQWV YL I     +  +  TL + GQL  ++R +    FN  A+
Sbjct: 560 LEELLTGTNDKIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQLTAKEREIVLRDFN--AN 617

Query: 694 TQHRILLLSIKCGGVGLNL 750
            + R+LLLS+  GGVGLNL
Sbjct: 618 NEKRVLLLSLTAGGVGLNL 636



 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 6/92 (6%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM-LNKNNDSTNRIKSIIKKI 182
           L A   W +TGTP+ N+  D+++++ F+    F D + WK  LN++     R+  IIK +
Sbjct: 252 LRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQQWKKNLNESMLGHRRLNFIIKPL 311

Query: 183 VLKRDKSEISFN-----IPKHTVEYVHVNLMK 263
           +L+R K ++  +     +P   +E + V L K
Sbjct: 312 MLRRTKQKLQASGDMPALPSLKIELICVQLSK 343



 Score = 30.7 bits (66), Expect = 2.4
 Identities = 11/18 (61%), Positives = 15/18 (83%)
 Frame = +2

Query: 374 HVLWLILKLRQICCHPYL 427
           ++L L+L+LRQ CCHP L
Sbjct: 418 YILVLLLRLRQFCCHPGL 435


>AE014297-672|AAF54166.1|  965|Drosophila melanogaster CG10445-PA
            protein.
          Length = 965

 Score = 65.3 bits (152), Expect = 9e-11
 Identities = 33/79 (41%), Positives = 50/79 (63%)
 Frame = +1

Query: 514  VDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            ++++L  ++DKII+ SQWV YL I     +  +  TL + GQL  ++R +    FN  A+
Sbjct: 799  LEELLTGTNDKIIVTSQWVSYLAIVRKRLQDLSWETLDFNGQLTAKEREIVLRDFN--AN 856

Query: 694  TQHRILLLSIKCGGVGLNL 750
             + R+LLLS+  GGVGLNL
Sbjct: 857  NEKRVLLLSLTAGGVGLNL 875



 Score = 52.0 bits (119), Expect = 9e-07
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 6/92 (6%)
 Frame = +3

Query: 6   LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM-LNKNNDSTNRIKSIIKKI 182
           L A   W +TGTP+ N+  D+++++ F+    F D + WK  LN++     R+  IIK +
Sbjct: 491 LRAHCHWALTGTPVQNRGVDVFALLRFVNVPNFQDLQQWKKNLNESMLGHRRLNFIIKPL 550

Query: 183 VLKRDKSEISFN-----IPKHTVEYVHVNLMK 263
           +L+R K ++  +     +P   +E + V L K
Sbjct: 551 MLRRTKQKLQASGDMPALPSLKIELICVQLSK 582



 Score = 30.7 bits (66), Expect = 2.4
 Identities = 11/18 (61%), Positives = 15/18 (83%)
 Frame = +2

Query: 374 HVLWLILKLRQICCHPYL 427
           ++L L+L+LRQ CCHP L
Sbjct: 657 YILVLLLRLRQFCCHPGL 674


>Y10229-1|CAA71278.1|  784|Drosophila melanogaster RAD54 protein.
          Length = 784

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 24/77 (31%), Positives = 43/77 (55%)
 Frame = +1

Query: 538 DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLL 717
           +DK++L+S + + L +FE   +++    +   G + ++ R      FN+  ++   + +L
Sbjct: 516 NDKVVLISNYTQTLDLFEQLARKRKYGFVRLDGTMSIKKRSKVVDRFND-PESDSFLFML 574

Query: 718 SIKCGGVGLNLIGGNTL 768
           S K GG GLNLIG N L
Sbjct: 575 SSKAGGCGLNLIGANRL 591


>AY069599-1|AAL39744.2|  788|Drosophila melanogaster LD35220p
           protein.
          Length = 788

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 24/77 (31%), Positives = 43/77 (55%)
 Frame = +1

Query: 538 DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLL 717
           +DK++L+S + + L +FE   +++    +   G + ++ R      FN+  ++   + +L
Sbjct: 520 NDKVVLISNYTQTLDLFEQLARKRKYGFVRLDGTMSIKKRSKVVDRFND-PESDSFLFML 578

Query: 718 SIKCGGVGLNLIGGNTL 768
           S K GG GLNLIG N L
Sbjct: 579 SSKAGGCGLNLIGANRL 595


>AF069780-1|AAC26857.1|  628|Drosophila melanogaster RAD54 DNA
           repair protein protein.
          Length = 628

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 24/77 (31%), Positives = 43/77 (55%)
 Frame = +1

Query: 538 DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLL 717
           +DK++L+S + + L +FE   +++    +   G + ++ R      FN+  ++   + +L
Sbjct: 360 NDKVVLISNYTQTLDLFEQLARKRKYGFVRLDGTMSIKKRSKVVDRFND-PESDSFLFML 418

Query: 718 SIKCGGVGLNLIGGNTL 768
           S K GG GLNLIG N L
Sbjct: 419 SSKAGGCGLNLIGANRL 435


>AF069779-1|AAC24577.1|  784|Drosophila melanogaster Rad54 homolog
           OKR protein.
          Length = 784

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 24/77 (31%), Positives = 43/77 (55%)
 Frame = +1

Query: 538 DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLL 717
           +DK++L+S + + L +FE   +++    +   G + ++ R      FN+  ++   + +L
Sbjct: 516 NDKVVLISNYTQTLDLFEQLARKRKYGFVRLDGTMSIKKRSKVVDRFND-PESDSFLFML 574

Query: 718 SIKCGGVGLNLIGGNTL 768
           S K GG GLNLIG N L
Sbjct: 575 SSKAGGCGLNLIGANRL 591


>AE014134-530|AAF51168.1|  784|Drosophila melanogaster CG3736-PA
           protein.
          Length = 784

 Score = 51.2 bits (117), Expect = 2e-06
 Identities = 24/77 (31%), Positives = 43/77 (55%)
 Frame = +1

Query: 538 DDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHRILLL 717
           +DK++L+S + + L +FE   +++    +   G + ++ R      FN+  ++   + +L
Sbjct: 516 NDKVVLISNYTQTLDLFEQLARKRKYGFVRLDGTMSIKKRSKVVDRFND-PESDSFLFML 574

Query: 718 SIKCGGVGLNLIGGNTL 768
           S K GG GLNLIG N L
Sbjct: 575 SSKAGGCGLNLIGANRL 591


>AF007780-1|AAB87384.1| 1518|Drosophila melanogaster CHD3 protein.
          Length = 1518

 Score = 44.8 bits (101), Expect = 1e-04
 Identities = 31/106 (29%), Positives = 53/106 (50%), Gaps = 7/106 (6%)
 Frame = +1

Query: 472 NGLYEQQVQTSAHLVDDILN-------TSDDKIILVSQWVEYLKIFENFFKQKNIATLMY 630
           +GLYE    T A    D+L+         + +++L SQ  + L I E+F + +       
Sbjct: 576 SGLYEMSSLTKASGKLDLLSKMLKQLKADNHRVLLFSQMTKMLNILEHFLEGEGYQYDRI 635

Query: 631 TGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            G +K + R  A   FN+   ++H + LLS + GG+G+NL   +T+
Sbjct: 636 DGSIKGDLRQKAIDRFNDPV-SEHFVFLLSTRAGGLGINLATADTV 680



 Score = 40.3 bits (90), Expect = 0.003
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIKKIVLKRDK 200
           +TGTP+ N   +++ ++NFL    FND + ++         +   R+  I++  +L+R K
Sbjct: 439 LTGTPLQNNLEELFHLLNFLSSGKFNDLQTFQAEFTDVSKEEQVKRLHEILEPHMLRRLK 498

Query: 201 SEISFNIPKHTVEYVHVNLMKKKKR 275
           +++  ++P  +   V V L   +K+
Sbjct: 499 ADVLKSMPPKSEFIVRVELSSMQKK 523


>AE014296-3147|AAF49162.2|  892|Drosophila melanogaster CG9594-PA
           protein.
          Length = 892

 Score = 44.4 bits (100), Expect = 2e-04
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 7/106 (6%)
 Frame = +1

Query: 472 NGLYEQQVQTSAHLVDDILN-------TSDDKIILVSQWVEYLKIFENFFKQKNIATLMY 630
           +GLYE    T A    D+L+         + +++L SQ  + L + E+F + +       
Sbjct: 573 SGLYEMSSLTKASGKLDLLSKMLKQLKADNHRVLLFSQMTKMLNVLEHFLEGEGYQYDRI 632

Query: 631 TGQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            G +K + R  A   FN+   ++H + LLS + GG+G+NL   +T+
Sbjct: 633 DGSIKGDLRQKAIDRFNDPV-SEHFVFLLSTRAGGLGINLATADTV 677



 Score = 40.3 bits (90), Expect = 0.003
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIKKIVLKRDK 200
           +TGTP+ N   +++ ++NFL    FND + ++         +   R+  I++  +L+R K
Sbjct: 436 LTGTPLQNNLEELFHLLNFLSSGKFNDLQTFQAEFTDVSKEEQVKRLHEILEPHMLRRLK 495

Query: 201 SEISFNIPKHTVEYVHVNLMKKKKR 275
           +++  ++P  +   V V L   +K+
Sbjct: 496 ADVLKSMPPKSEFIVRVELSSMQKK 520


>AY058653-1|AAL13882.1| 1207|Drosophila melanogaster LD35434p protein.
          Length = 1207

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 26/93 (27%), Positives = 45/93 (48%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++QT   L+   L  +  ++++ +Q  + L + E F        L   G  +VE R +  
Sbjct: 820  KLQTMDRLLRQ-LKVNGHRVLIFTQMTKMLDVLEAFLNYHGHIYLRLDGSTRVEQRQILM 878

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   D +    +LS + GGVG+NL G +T+
Sbjct: 879  ERFNG--DKRIFCFILSTRSGGVGINLTGADTV 909



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 13/90 (14%)
 Frame = +3

Query: 21  RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------MLNKN---NDS-TNRI 161
           R  +TGTP+ N   +++S+++FL    F+  R +K         M+  N   N++   R+
Sbjct: 227 RLLLTGTPLQNDLMELWSLMHFLMPYVFSSHREFKEWFSNPMTGMIEGNMEYNETLITRL 286

Query: 162 KSIIKKIVLKRDKSEISFNIPKHTVEYVHV 251
             +I+  +L+R K E+   +PK   +Y HV
Sbjct: 287 HKVIRPFLLRRLKKEVEKQMPK---KYEHV 313


>AY051813-1|AAK93237.1| 1095|Drosophila melanogaster LD32234p
           protein.
          Length = 1095

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 26/93 (27%), Positives = 45/93 (48%)
 Frame = +1

Query: 490 QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
           ++QT   L+   L  +  ++++ +Q  + L + E F        L   G  +VE R +  
Sbjct: 257 KLQTMDRLLRQ-LKVNGHRVLIFTQMTKMLDVLEAFLNYHGHIYLRLDGSTRVEQRQILM 315

Query: 670 TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
             FN   D +    +LS + GGVG+NL G +T+
Sbjct: 316 ERFNG--DKRIFCFILSTRSGGVGINLTGADTV 346


>AF254373-1|AAK53539.1| 2497|Drosophila melanogaster DOMINO B protein.
          Length = 2497

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 26/93 (27%), Positives = 45/93 (48%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++QT   L+   L  +  ++++ +Q  + L + E F        L   G  +VE R +  
Sbjct: 1659 KLQTMDRLLRQ-LKVNGHRVLIFTQMTKMLDVLEAFLNYHGHIYLRLDGSTRVEQRQILM 1717

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   D +    +LS + GGVG+NL G +T+
Sbjct: 1718 ERFNG--DKRIFCFILSTRSGGVGINLTGADTV 1748



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 13/90 (14%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------MLNKN---NDS-TNRI 161
            R  +TGTP+ N   +++S+++FL    F+  R +K         M+  N   N++   R+
Sbjct: 1066 RLLLTGTPLQNDLMELWSLMHFLMPYVFSSHREFKEWFSNPMTGMIEGNMEYNETLITRL 1125

Query: 162  KSIIKKIVLKRDKSEISFNIPKHTVEYVHV 251
              +I+  +L+R K E+   +PK   +Y HV
Sbjct: 1126 HKVIRPFLLRRLKKEVEKQMPK---KYEHV 1152


>AF076776-1|AAF82185.1| 3201|Drosophila melanogaster helicase DOMINO A
            protein.
          Length = 3201

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 26/93 (27%), Positives = 45/93 (48%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++QT   L+   L  +  ++++ +Q  + L + E F        L   G  +VE R +  
Sbjct: 1659 KLQTMDRLLRQ-LKVNGHRVLIFTQMTKMLDVLEAFLNYHGHIYLRLDGSTRVEQRQILM 1717

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   D +    +LS + GGVG+NL G +T+
Sbjct: 1718 ERFNG--DKRIFCFILSTRSGGVGINLTGADTV 1748



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 13/90 (14%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------MLNKN---NDS-TNRI 161
            R  +TGTP+ N   +++S+++FL    F+  R +K         M+  N   N++   R+
Sbjct: 1066 RLLLTGTPLQNDLMELWSLMHFLMPYVFSSHREFKEWFSNPMTGMIEGNMEYNETLITRL 1125

Query: 162  KSIIKKIVLKRDKSEISFNIPKHTVEYVHV 251
              +I+  +L+R K E+   +PK   +Y HV
Sbjct: 1126 HKVIRPFLLRRLKKEVEKQMPK---KYEHV 1152


>AE013599-3190|AAM70872.2| 2497|Drosophila melanogaster CG9696-PE,
            isoform E protein.
          Length = 2497

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 26/93 (27%), Positives = 45/93 (48%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++QT   L+   L  +  ++++ +Q  + L + E F        L   G  +VE R +  
Sbjct: 1659 KLQTMDRLLRQ-LKVNGHRVLIFTQMTKMLDVLEAFLNYHGHIYLRLDGSTRVEQRQILM 1717

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   D +    +LS + GGVG+NL G +T+
Sbjct: 1718 ERFNG--DKRIFCFILSTRSGGVGINLTGADTV 1748



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 13/90 (14%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------MLNKN---NDS-TNRI 161
            R  +TGTP+ N   +++S+++FL    F+  R +K         M+  N   N++   R+
Sbjct: 1066 RLLLTGTPLQNDLMELWSLMHFLMPYVFSSHREFKEWFSNPMTGMIEGNMEYNETLITRL 1125

Query: 162  KSIIKKIVLKRDKSEISFNIPKHTVEYVHV 251
              +I+  +L+R K E+   +PK   +Y HV
Sbjct: 1126 HKVIRPFLLRRLKKEVEKQMPK---KYEHV 1152


>AE013599-3189|AAM70871.1| 3198|Drosophila melanogaster CG9696-PA,
            isoform A protein.
          Length = 3198

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 26/93 (27%), Positives = 45/93 (48%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++QT   L+   L  +  ++++ +Q  + L + E F        L   G  +VE R +  
Sbjct: 1659 KLQTMDRLLRQ-LKVNGHRVLIFTQMTKMLDVLEAFLNYHGHIYLRLDGSTRVEQRQILM 1717

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   D +    +LS + GGVG+NL G +T+
Sbjct: 1718 ERFNG--DKRIFCFILSTRSGGVGINLTGADTV 1748



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 13/90 (14%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------MLNKN---NDS-TNRI 161
            R  +TGTP+ N   +++S+++FL    F+  R +K         M+  N   N++   R+
Sbjct: 1066 RLLLTGTPLQNDLMELWSLMHFLMPYVFSSHREFKEWFSNPMTGMIEGNMEYNETLITRL 1125

Query: 162  KSIIKKIVLKRDKSEISFNIPKHTVEYVHV 251
              +I+  +L+R K E+   +PK   +Y HV
Sbjct: 1126 HKVIRPFLLRRLKKEVEKQMPK---KYEHV 1152


>AE013599-3188|AAM70870.1| 3183|Drosophila melanogaster CG9696-PD,
            isoform D protein.
          Length = 3183

 Score = 41.9 bits (94), Expect = 0.001
 Identities = 26/93 (27%), Positives = 45/93 (48%)
 Frame = +1

Query: 490  QVQTSAHLVDDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAE 669
            ++QT   L+   L  +  ++++ +Q  + L + E F        L   G  +VE R +  
Sbjct: 1659 KLQTMDRLLRQ-LKVNGHRVLIFTQMTKMLDVLEAFLNYHGHIYLRLDGSTRVEQRQILM 1717

Query: 670  TTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
              FN   D +    +LS + GGVG+NL G +T+
Sbjct: 1718 ERFNG--DKRIFCFILSTRSGGVGINLTGADTV 1748



 Score = 34.3 bits (75), Expect = 0.19
 Identities = 26/90 (28%), Positives = 47/90 (52%), Gaps = 13/90 (14%)
 Frame = +3

Query: 21   RWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---------MLNKN---NDS-TNRI 161
            R  +TGTP+ N   +++S+++FL    F+  R +K         M+  N   N++   R+
Sbjct: 1066 RLLLTGTPLQNDLMELWSLMHFLMPYVFSSHREFKEWFSNPMTGMIEGNMEYNETLITRL 1125

Query: 162  KSIIKKIVLKRDKSEISFNIPKHTVEYVHV 251
              +I+  +L+R K E+   +PK   +Y HV
Sbjct: 1126 HKVIRPFLLRRLKKEVEKQMPK---KYEHV 1152


>M85049-1|AAA19661.1| 1638|Drosophila melanogaster brahma protein
            protein.
          Length = 1638

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 10/165 (6%)
 Frame = +1

Query: 304  RGVYESCGSA*KRKHAKPIAANAARVMANTEIEANLL---PPVFGHAR*K----SFGNKR 462
            +GV  + GS  K KH K      A+ + NT ++   L   P +F H   K    + G+  
Sbjct: 1033 KGVLLTDGSE-KGKHGK----GGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGV 1087

Query: 463  LF*NGLYEQQVQTSAHLVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT 633
            +    LY  +V     L+D IL     ++ +++L  Q  + + I E++   +    L   
Sbjct: 1088 VSGPDLY--RVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLD 1145

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            G  K EDR      FN A  +   + LLS + GG+GLNL   +T+
Sbjct: 1146 GTTKAEDRGELLRKFN-AKGSDVFVFLLSTRAGGLGLNLQTADTV 1189



 Score = 33.5 bits (73), Expect = 0.34
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + +  N + T 
Sbjct: 922  APYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETI 981

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P   VEY+
Sbjct: 982  LIIRRLHKVLRPFLLRRLKKEVEHQLP-DKVEYI 1014


>BT009972-1|AAQ22441.1| 1634|Drosophila melanogaster RE61274p protein.
          Length = 1634

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 10/165 (6%)
 Frame = +1

Query: 304  RGVYESCGSA*KRKHAKPIAANAARVMANTEIEANLL---PPVFGHAR*K----SFGNKR 462
            +GV  + GS  K KH K      A+ + NT ++   L   P +F H   K    + G+  
Sbjct: 1029 KGVLLTDGSE-KGKHGK----GGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGV 1083

Query: 463  LF*NGLYEQQVQTSAHLVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT 633
            +    LY  +V     L+D IL     ++ +++L  Q  + + I E++   +    L   
Sbjct: 1084 VSGPDLY--RVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLD 1141

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            G  K EDR      FN A  +   + LLS + GG+GLNL   +T+
Sbjct: 1142 GTTKAEDRGELLRKFN-AKGSDVFVFLLSTRAGGLGLNLQTADTV 1185



 Score = 33.5 bits (73), Expect = 0.34
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + +  N + T 
Sbjct: 918  APYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETI 977

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P   VEY+
Sbjct: 978  LIIRRLHKVLRPFLLRRLKKEVEHQLP-DKVEYI 1010


>AY095048-1|AAM11376.1| 1638|Drosophila melanogaster LD36356p protein.
          Length = 1638

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 10/165 (6%)
 Frame = +1

Query: 304  RGVYESCGSA*KRKHAKPIAANAARVMANTEIEANLL---PPVFGHAR*K----SFGNKR 462
            +GV  + GS  K KH K      A+ + NT ++   L   P +F H   K    + G+  
Sbjct: 1033 KGVLLTDGSE-KGKHGK----GGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGV 1087

Query: 463  LF*NGLYEQQVQTSAHLVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT 633
            +    LY  +V     L+D IL     ++ +++L  Q  + + I E++   +    L   
Sbjct: 1088 VSGPDLY--RVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLD 1145

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            G  K EDR      FN A  +   + LLS + GG+GLNL   +T+
Sbjct: 1146 GTTKAEDRGELLRKFN-AKGSDVFVFLLSTRAGGLGLNLQTADTV 1189



 Score = 33.5 bits (73), Expect = 0.34
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + +  N + T 
Sbjct: 922  APYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETI 981

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P   VEY+
Sbjct: 982  LIIRRLHKVLRPFLLRRLKKEVEHQLP-DKVEYI 1014


>AE014296-2605|AAF49557.1| 1638|Drosophila melanogaster CG5942-PB,
            isoform B protein.
          Length = 1638

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 10/165 (6%)
 Frame = +1

Query: 304  RGVYESCGSA*KRKHAKPIAANAARVMANTEIEANLL---PPVFGHAR*K----SFGNKR 462
            +GV  + GS  K KH K      A+ + NT ++   L   P +F H   K    + G+  
Sbjct: 1033 KGVLLTDGSE-KGKHGK----GGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGV 1087

Query: 463  LF*NGLYEQQVQTSAHLVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT 633
            +    LY  +V     L+D IL     ++ +++L  Q  + + I E++   +    L   
Sbjct: 1088 VSGPDLY--RVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLD 1145

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            G  K EDR      FN A  +   + LLS + GG+GLNL   +T+
Sbjct: 1146 GTTKAEDRGELLRKFN-AKGSDVFVFLLSTRAGGLGLNLQTADTV 1189



 Score = 33.5 bits (73), Expect = 0.34
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + +  N + T 
Sbjct: 922  APYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETI 981

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P   VEY+
Sbjct: 982  LIIRRLHKVLRPFLLRRLKKEVEHQLP-DKVEYI 1014


>AE014296-2604|AAF49558.3| 1638|Drosophila melanogaster CG5942-PA,
            isoform A protein.
          Length = 1638

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 10/165 (6%)
 Frame = +1

Query: 304  RGVYESCGSA*KRKHAKPIAANAARVMANTEIEANLL---PPVFGHAR*K----SFGNKR 462
            +GV  + GS  K KH K      A+ + NT ++   L   P +F H   K    + G+  
Sbjct: 1033 KGVLLTDGSE-KGKHGK----GGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGV 1087

Query: 463  LF*NGLYEQQVQTSAHLVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT 633
            +    LY  +V     L+D IL     ++ +++L  Q  + + I E++   +    L   
Sbjct: 1088 VSGPDLY--RVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLD 1145

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            G  K EDR      FN A  +   + LLS + GG+GLNL   +T+
Sbjct: 1146 GTTKAEDRGELLRKFN-AKGSDVFVFLLSTRAGGLGLNLQTADTV 1189



 Score = 33.5 bits (73), Expect = 0.34
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + +  N + T 
Sbjct: 922  APYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETI 981

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P   VEY+
Sbjct: 982  LIIRRLHKVLRPFLLRRLKKEVEHQLP-DKVEYI 1014


>AE014296-2603|AAN11774.1| 1634|Drosophila melanogaster CG5942-PD,
            isoform D protein.
          Length = 1634

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 10/165 (6%)
 Frame = +1

Query: 304  RGVYESCGSA*KRKHAKPIAANAARVMANTEIEANLL---PPVFGHAR*K----SFGNKR 462
            +GV  + GS  K KH K      A+ + NT ++   L   P +F H   K    + G+  
Sbjct: 1029 KGVLLTDGSE-KGKHGK----GGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGV 1083

Query: 463  LF*NGLYEQQVQTSAHLVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT 633
            +    LY  +V     L+D IL     ++ +++L  Q  + + I E++   +    L   
Sbjct: 1084 VSGPDLY--RVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLD 1141

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            G  K EDR      FN A  +   + LLS + GG+GLNL   +T+
Sbjct: 1142 GTTKAEDRGELLRKFN-AKGSDVFVFLLSTRAGGLGLNLQTADTV 1185



 Score = 33.5 bits (73), Expect = 0.34
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + +  N + T 
Sbjct: 918  APYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETI 977

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P   VEY+
Sbjct: 978  LIIRRLHKVLRPFLLRRLKKEVEHQLP-DKVEYI 1010


>AE014296-2602|AAN11773.1| 1634|Drosophila melanogaster CG5942-PC,
            isoform C protein.
          Length = 1634

 Score = 41.1 bits (92), Expect = 0.002
 Identities = 47/165 (28%), Positives = 75/165 (45%), Gaps = 10/165 (6%)
 Frame = +1

Query: 304  RGVYESCGSA*KRKHAKPIAANAARVMANTEIEANLL---PPVFGHAR*K----SFGNKR 462
            +GV  + GS  K KH K      A+ + NT ++   L   P +F H   K    + G+  
Sbjct: 1029 KGVLLTDGSE-KGKHGK----GGAKALMNTIVQLRKLCNHPFMFQHIEEKYCDHTGGHGV 1083

Query: 463  LF*NGLYEQQVQTSAHLVDDIL---NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT 633
            +    LY  +V     L+D IL     ++ +++L  Q  + + I E++   +    L   
Sbjct: 1084 VSGPDLY--RVSGKFELLDRILPKLKATNHRVLLFCQMTQCMTIIEDYLGWRQFGYLRLD 1141

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGNTL 768
            G  K EDR      FN A  +   + LLS + GG+GLNL   +T+
Sbjct: 1142 GTTKAEDRGELLRKFN-AKGSDVFVFLLSTRAGGLGLNLQTADTV 1185



 Score = 33.5 bits (73), Expect = 0.34
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 16/94 (17%)
 Frame = +3

Query: 12   ATNRWCITGTPIHNKHWDMYSMINFL------QCRP----FNDP--RVWKMLNKNNDST- 152
            A  R  +TGTP+ NK  ++++++NFL       C      FN P     + +  N + T 
Sbjct: 918  APYRLLLTGTPLQNKLPELWALLNFLLPSIFKSCSTFEQWFNAPFATTGEKVELNEEETI 977

Query: 153  ---NRIKSIIKKIVLKRDKSEISFNIPKHTVEYV 245
                R+  +++  +L+R K E+   +P   VEY+
Sbjct: 978  LIIRRLHKVLRPFLLRRLKKEVEHQLP-DKVEYI 1010


>AY071503-1|AAL49125.1|  627|Drosophila melanogaster RE55932p
           protein.
          Length = 627

 Score = 40.3 bits (90), Expect = 0.003
 Identities = 21/85 (24%), Positives = 45/85 (52%), Gaps = 3/85 (3%)
 Frame = +3

Query: 30  ITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKML---NKNNDSTNRIKSIIKKIVLKRDK 200
           +TGTP+ N   +++ ++NFL    FND + ++         +   R+  I++  +L+R K
Sbjct: 436 LTGTPLQNNLEELFHLLNFLSSGKFNDLQTFQAEFTDVSKEEQVKRLHEILEPHMLRRLK 495

Query: 201 SEISFNIPKHTVEYVHVNLMKKKKR 275
           +++  ++P  +   V V L   +K+
Sbjct: 496 ADVLKSMPPKSEFIVRVELSSMQKK 520


>L77907-1|AAC37264.1| 1883|Drosophila melanogaster
            chromodomain-helicase-DNA-bindingprotein protein.
          Length = 1883

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 23/81 (28%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++ SQ V  L +  ++ ++++       G +K E R  A   FN A  +Q  
Sbjct: 848  LKETGHRVLIFSQMVRMLDVLADYLQKRHFPFQRLDGSIKGEMRRQALDHFN-AEGSQDF 906

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 907  CFLLSTRAGGLGINLATADTV 927



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 17/88 (19%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDST--NRIKSIIKKIVLK 191
           +R  ITGTP+ N   +++++++F+    F+    +++ + N +     R+   ++  +L+
Sbjct: 684 HRLLITGTPLQNSLKELWALLHFIMPDKFDTWENFEVQHGNAEDKGHTRLHQQLEPYILR 743

Query: 192 RDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           R K ++  ++P    + + V +   +K+
Sbjct: 744 RVKKDVEKSLPAKVEQILRVEMTSLQKQ 771


>BT011071-1|AAR82736.1| 1645|Drosophila melanogaster SD21488p protein.
          Length = 1645

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 23/81 (28%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++ SQ V  L +  ++ ++++       G +K E R  A   FN A  +Q  
Sbjct: 848  LKETGHRVLIFSQMVRMLDVLADYLQKRHFPFQRLDGSIKGEMRRQALDHFN-AEGSQDF 906

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 907  CFLLSTRAGGLGINLATADTV 927



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 17/88 (19%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDST--NRIKSIIKKIVLK 191
           +R  ITGTP+ N   +++++++F+    F+    +++ + N +     R+   ++  +L+
Sbjct: 684 HRLLITGTPLQNSLKELWALLHFIMPDKFDTWENFEVQHGNAEDKGYTRLHQQLEPYILR 743

Query: 192 RDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           R K ++  ++P    + + V +   +K+
Sbjct: 744 RVKKDVEKSLPAKVEQILRVEMTSLQKQ 771


>AY095050-1|AAM11378.1| 1101|Drosophila melanogaster LD39323p
           protein.
          Length = 1101

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 23/81 (28%), Positives = 42/81 (51%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L  +  ++++ SQ V  L +  ++ ++++       G +K E R  A   FN A  +Q  
Sbjct: 316 LKETGHRVLIFSQMVRMLDVLADYLQKRHFPFQRLDGSIKGEMRRQALDHFN-AEGSQDF 374

Query: 706 ILLLSIKCGGVGLNLIGGNTL 768
             LLS + GG+G+NL   +T+
Sbjct: 375 CFLLSTRAGGLGINLATADTV 395



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 17/88 (19%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDST--NRIKSIIKKIVLK 191
           +R  ITGTP+ N   +++++++F+    F+    +++ + N +     R+   ++  +L+
Sbjct: 152 HRLLITGTPLQNSLKELWALLHFIMPDKFDTWENFEVQHGNAEDKGYTRLHQQLEPYILR 211

Query: 192 RDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           R K ++  ++P    + + V +   +K+
Sbjct: 212 RVKKDVEKSLPAKVEQILRVEMTSLQKQ 239


>AF215703-1|AAF43004.1| 5322|Drosophila melanogaster KISMET-L long
            isoform protein.
          Length = 5322

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 23/96 (23%), Positives = 52/96 (54%), Gaps = 6/96 (6%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM---LNKNNDSTNRIKSIIK 176
            L   +R  ++GTP+ N   +++S++NFL+   F+    +       +  +  N++++++K
Sbjct: 2185 LNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLK 2244

Query: 177  KIVLKRDKSEISFNI-PKH--TVEYVHVNLMKKKKR 275
             ++L+R K ++  ++ PK    +E    N+ KK  R
Sbjct: 2245 PMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYR 2280



 Score = 32.3 bits (70), Expect = 0.78
 Identities = 19/81 (23%), Positives = 38/81 (46%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++ SQ V  L I E++   +        G+++   R  A   ++     +  
Sbjct: 2362 LKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIRGNLRQEAIDRYSKPGSDRF- 2420

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LL  K GG+G+NL   +T+
Sbjct: 2421 VFLLCTKAGGLGINLTAADTV 2441


>AE014134-528|AAF51170.1| 1883|Drosophila melanogaster CG3733-PA
            protein.
          Length = 1883

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 23/81 (28%), Positives = 42/81 (51%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++ SQ V  L +  ++ ++++       G +K E R  A   FN A  +Q  
Sbjct: 848  LKETGHRVLIFSQMVRMLDVLADYLQKRHFPFQRLDGSIKGEMRRQALDHFN-AEGSQDF 906

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
              LLS + GG+G+NL   +T+
Sbjct: 907  CFLLSTRAGGLGINLATADTV 927



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 17/88 (19%), Positives = 47/88 (53%), Gaps = 2/88 (2%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKMLNKNNDST--NRIKSIIKKIVLK 191
           +R  ITGTP+ N   +++++++F+    F+    +++ + N +     R+   ++  +L+
Sbjct: 684 HRLLITGTPLQNSLKELWALLHFIMPDKFDTWENFEVQHGNAEDKGYTRLHQQLEPYILR 743

Query: 192 RDKSEISFNIPKHTVEYVHVNLMKKKKR 275
           R K ++  ++P    + + V +   +K+
Sbjct: 744 RVKKDVEKSLPAKVEQILRVEMTSLQKQ 771


>AE014134-62|AAF51527.3| 5322|Drosophila melanogaster CG3696-PA,
            isoform A protein.
          Length = 5322

 Score = 39.9 bits (89), Expect = 0.004
 Identities = 23/96 (23%), Positives = 52/96 (54%), Gaps = 6/96 (6%)
 Frame = +3

Query: 6    LTATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWKM---LNKNNDSTNRIKSIIK 176
            L   +R  ++GTP+ N   +++S++NFL+   F+    +       +  +  N++++++K
Sbjct: 2185 LNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQEEFMSEFGSLRTEEEVNKLQALLK 2244

Query: 177  KIVLKRDKSEISFNI-PKH--TVEYVHVNLMKKKKR 275
             ++L+R K ++  ++ PK    +E    N+ KK  R
Sbjct: 2245 PMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYR 2280



 Score = 32.3 bits (70), Expect = 0.78
 Identities = 19/81 (23%), Positives = 38/81 (46%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++ SQ V  L I E++   +        G+++   R  A   ++     +  
Sbjct: 2362 LKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRIRGNLRQEAIDRYSKPGSDRF- 2420

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LL  K GG+G+NL   +T+
Sbjct: 2421 VFLLCTKAGGLGINLTAADTV 2441


>L27127-1|AAA19868.1| 1027|Drosophila melanogaster ISWI protein
           protein.
          Length = 1027

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 6/91 (6%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVWKMLNK--NNDS-TNRIKSIIKK 179
           NR  ITGTP+ N   ++++++NFL    FN   D   W   N    +D+   R+ +++K 
Sbjct: 279 NRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKP 338

Query: 180 IVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
            +L+R K+E+   +       + V L K ++
Sbjct: 339 FLLRRLKAEVEKRLKPKKEMKIFVGLSKMQR 369



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 21/75 (28%), Positives = 34/75 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    L I E++   +N       GQ   EDR      FN     +  
Sbjct: 443 LQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKF- 501

Query: 706 ILLLSIKCGGVGLNL 750
           + +LS + GG+G+NL
Sbjct: 502 LFMLSTRAGGLGINL 516


>AY094908-1|AAM11261.1| 1027|Drosophila melanogaster RH13158p
           protein.
          Length = 1027

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 6/91 (6%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVWKMLNK--NNDS-TNRIKSIIKK 179
           NR  ITGTP+ N   ++++++NFL    FN   D   W   N    +D+   R+ +++K 
Sbjct: 279 NRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKP 338

Query: 180 IVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
            +L+R K+E+   +       + V L K ++
Sbjct: 339 FLLRRLKAEVEKRLKPKKEMKIFVGLSKMQR 369



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 21/75 (28%), Positives = 34/75 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    L I E++   +N       GQ   EDR      FN     +  
Sbjct: 443 LQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKF- 501

Query: 706 ILLLSIKCGGVGLNL 750
           + +LS + GG+G+NL
Sbjct: 502 LFMLSTRAGGLGINL 516


>AF119716-1|AAD17276.1| 1982|Drosophila melanogaster dMi-2 protein
            protein.
          Length = 1982

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 22/92 (23%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +3

Query: 9    TATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---MLNKNNDSTNRIKSIIKK 179
            T   +  +TGTP+ N   +++ ++NFL    FND + ++         +   R+  ++  
Sbjct: 895  TIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGP 954

Query: 180  IVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
             +L+R K+++  N+P  +   V V L   +K+
Sbjct: 955  HMLRRLKTDVLKNMPSKSEFIVRVELSAMQKK 986



 Score = 36.3 bits (80), Expect = 0.048
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L   + ++++ SQ  + L I E+F + +        G +    R  A   FN A   Q  
Sbjct: 1064 LKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFN-APGAQQF 1122

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1123 VFLLSTRAGGLGINLATADTV 1143


>AE014296-3240|AAX52739.1| 1983|Drosophila melanogaster CG8103-PB,
            isoform B protein.
          Length = 1983

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 22/92 (23%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +3

Query: 9    TATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---MLNKNNDSTNRIKSIIKK 179
            T   +  +TGTP+ N   +++ ++NFL    FND + ++         +   R+  ++  
Sbjct: 896  TIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGP 955

Query: 180  IVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
             +L+R K+++  N+P  +   V V L   +K+
Sbjct: 956  HMLRRLKTDVLKNMPSKSEFIVRVELSAMQKK 987



 Score = 36.3 bits (80), Expect = 0.048
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L   + ++++ SQ  + L I E+F + +        G +    R  A   FN A   Q  
Sbjct: 1065 LKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFN-APGAQQF 1123

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1124 VFLLSTRAGGLGINLATADTV 1144


>AE014296-3239|AAF49099.2| 1982|Drosophila melanogaster CG8103-PA,
            isoform A protein.
          Length = 1982

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 22/92 (23%), Positives = 46/92 (50%), Gaps = 3/92 (3%)
 Frame = +3

Query: 9    TATNRWCITGTPIHNKHWDMYSMINFLQCRPFNDPRVWK---MLNKNNDSTNRIKSIIKK 179
            T   +  +TGTP+ N   +++ ++NFL    FND + ++         +   R+  ++  
Sbjct: 895  TIAYKLLLTGTPLQNNLEELFHLLNFLSRDKFNDLQAFQGEFADVSKEEQVKRLHEMLGP 954

Query: 180  IVLKRDKSEISFNIPKHTVEYVHVNLMKKKKR 275
             +L+R K+++  N+P  +   V V L   +K+
Sbjct: 955  HMLRRLKTDVLKNMPSKSEFIVRVELSAMQKK 986



 Score = 36.3 bits (80), Expect = 0.048
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L   + ++++ SQ  + L I E+F + +        G +    R  A   FN A   Q  
Sbjct: 1064 LKAQNHRVLIFSQMTKMLDILEDFLEGEQYKYERIDGGITGTLRQEAIDRFN-APGAQQF 1122

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1123 VFLLSTRAGGLGINLATADTV 1143


>AE013599-1548|AAM68638.1| 1027|Drosophila melanogaster CG8625-PC,
           isoform C protein.
          Length = 1027

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 6/91 (6%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVWKMLNK--NNDS-TNRIKSIIKK 179
           NR  ITGTP+ N   ++++++NFL    FN   D   W   N    +D+   R+ +++K 
Sbjct: 279 NRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKP 338

Query: 180 IVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
            +L+R K+E+   +       + V L K ++
Sbjct: 339 FLLRRLKAEVEKRLKPKKEMKIFVGLSKMQR 369



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 21/75 (28%), Positives = 34/75 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    L I E++   +N       GQ   EDR      FN     +  
Sbjct: 443 LQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKF- 501

Query: 706 ILLLSIKCGGVGLNL 750
           + +LS + GG+G+NL
Sbjct: 502 LFMLSTRAGGLGINL 516


>AE013599-1547|AAM68637.1| 1027|Drosophila melanogaster CG8625-PB,
           isoform B protein.
          Length = 1027

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 6/91 (6%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVWKMLNK--NNDS-TNRIKSIIKK 179
           NR  ITGTP+ N   ++++++NFL    FN   D   W   N    +D+   R+ +++K 
Sbjct: 279 NRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKP 338

Query: 180 IVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
            +L+R K+E+   +       + V L K ++
Sbjct: 339 FLLRRLKAEVEKRLKPKKEMKIFVGLSKMQR 369



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 21/75 (28%), Positives = 34/75 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    L I E++   +N       GQ   EDR      FN     +  
Sbjct: 443 LQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKF- 501

Query: 706 ILLLSIKCGGVGLNL 750
           + +LS + GG+G+NL
Sbjct: 502 LFMLSTRAGGLGINL 516


>AE013599-1546|AAF58479.1| 1027|Drosophila melanogaster CG8625-PA,
           isoform A protein.
          Length = 1027

 Score = 39.1 bits (87), Expect = 0.007
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 6/91 (6%)
 Frame = +3

Query: 18  NRWCITGTPIHNKHWDMYSMINFLQCRPFN---DPRVWKMLNK--NNDS-TNRIKSIIKK 179
           NR  ITGTP+ N   ++++++NFL    FN   D   W   N    +D+   R+ +++K 
Sbjct: 279 NRLLITGTPLQNNLHELWALLNFLLPDVFNSSEDFDEWFNTNTCLGDDALITRLHAVLKP 338

Query: 180 IVLKRDKSEISFNIPKHTVEYVHVNLMKKKK 272
            +L+R K+E+   +       + V L K ++
Sbjct: 339 FLLRRLKAEVEKRLKPKKEMKIFVGLSKMQR 369



 Score = 35.1 bits (77), Expect = 0.11
 Identities = 21/75 (28%), Positives = 34/75 (45%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     ++++ SQ    L I E++   +N       GQ   EDR      FN     +  
Sbjct: 443 LQEQGSRVLIFSQMTRMLDILEDYCHWRNYNYCRLDGQTPHEDRNRQIQEFNMDNSAKF- 501

Query: 706 ILLLSIKCGGVGLNL 750
           + +LS + GG+G+NL
Sbjct: 502 LFMLSTRAGGLGINL 516


>AE014134-1718|ABC65886.1|  831|Drosophila melanogaster CG5899-PC,
           isoform C protein.
          Length = 831

 Score = 38.7 bits (86), Expect = 0.009
 Identities = 25/80 (31%), Positives = 35/80 (43%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     +++L SQ+   L I E + + +        G   V  R    T FN   D    
Sbjct: 651 LKAEGHRVLLFSQFTMMLDIVEEYLRIRKFGFCRLDGATAVNVRQDLITDFNG--DDSIF 708

Query: 706 ILLLSIKCGGVGLNLIGGNT 765
           + LLS K GGVG+NL   +T
Sbjct: 709 VFLLSTKAGGVGINLTAADT 728


>AE014134-1717|AAF52824.1|  844|Drosophila melanogaster CG5899-PA,
           isoform A protein.
          Length = 844

 Score = 38.7 bits (86), Expect = 0.009
 Identities = 25/80 (31%), Positives = 35/80 (43%)
 Frame = +1

Query: 526 LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
           L     +++L SQ+   L I E + + +        G   V  R    T FN   D    
Sbjct: 664 LKAEGHRVLLFSQFTMMLDIVEEYLRIRKFGFCRLDGATAVNVRQDLITDFNG--DDSIF 721

Query: 706 ILLLSIKCGGVGLNLIGGNT 765
           + LLS K GGVG+NL   +T
Sbjct: 722 VFLLSTKAGGVGINLTAADT 741


>AY069822-1|AAL39967.1|  655|Drosophila melanogaster SD07188p
           protein.
          Length = 655

 Score = 37.1 bits (82), Expect = 0.027
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +1

Query: 634 GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
           G   VE R      FNN  + + R+ L+S + GG+G+NL+  N
Sbjct: 312 GSCSVEQREAMCKQFNNITNLRARLFLISTRAGGLGINLVAAN 354


>AY058592-1|AAL13821.1| 1311|Drosophila melanogaster LD28477p protein.
          Length = 1311

 Score = 37.1 bits (82), Expect = 0.027
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +1

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            G   VE R      FNN  + + R+ L+S + GG+G+NL+  N
Sbjct: 968  GSCSVEQREAMCKQFNNITNLRARLFLISTRAGGLGINLVAAN 1010


>AF217802-1|AAG40586.1| 1311|Drosophila melanogaster xnp/atr-x DNA
            helicase protein.
          Length = 1311

 Score = 37.1 bits (82), Expect = 0.027
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +1

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            G   VE R      FNN  + + R+ L+S + GG+G+NL+  N
Sbjct: 968  GSCSVEQREAMCKQFNNITNLRARLFLISTRAGGLGINLVAAN 1010


>AE014297-3805|AAN14055.1| 1311|Drosophila melanogaster CG4548-PB,
            isoform B protein.
          Length = 1311

 Score = 37.1 bits (82), Expect = 0.027
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +1

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            G   VE R      FNN  + + R+ L+S + GG+G+NL+  N
Sbjct: 968  GSCSVEQREAMCKQFNNITNLRARLFLISTRAGGLGINLVAAN 1010


>AE014297-3804|AAF56471.1| 1311|Drosophila melanogaster CG4548-PA,
            isoform A protein.
          Length = 1311

 Score = 37.1 bits (82), Expect = 0.027
 Identities = 16/43 (37%), Positives = 24/43 (55%)
 Frame = +1

Query: 634  GQLKVEDRILAETTFNNAADTQHRILLLSIKCGGVGLNLIGGN 762
            G   VE R      FNN  + + R+ L+S + GG+G+NL+  N
Sbjct: 968  GSCSVEQREAMCKQFNNITNLRARLFLISTRAGGLGINLVAAN 1010


>AY069786-1|AAL39931.1| 1638|Drosophila melanogaster SD02886p protein.
          Length = 1638

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 19/81 (23%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++ SQ  + + + E +   +    +   G  K+  R      F   AD    
Sbjct: 1168 LKANGHRVLIYSQMTKMIDLLEEYMWHRKHRYMRLDGSSKISARRDMVADFQTRADIF-- 1225

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1226 VFLLSTRAGGLGINLTAADTV 1246


>AE014297-2651|AAF55658.2| 1638|Drosophila melanogaster CG31212-PA
            protein.
          Length = 1638

 Score = 35.1 bits (77), Expect = 0.11
 Identities = 19/81 (23%), Positives = 37/81 (45%)
 Frame = +1

Query: 526  LNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAADTQHR 705
            L  +  ++++ SQ  + + + E +   +    +   G  K+  R      F   AD    
Sbjct: 1168 LKANGHRVLIYSQMTKMIDLLEEYMWHRKHRYMRLDGSSKISARRDMVADFQTRADIF-- 1225

Query: 706  ILLLSIKCGGVGLNLIGGNTL 768
            + LLS + GG+G+NL   +T+
Sbjct: 1226 VFLLSTRAGGLGINLTAADTV 1246


>BT003614-1|AAO39617.1| 1221|Drosophila melanogaster GH12153p protein.
          Length = 1221

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 3/83 (3%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQ 699
            + S  + ++  Q    L I E    ++++ ++ Y    G +    R      FN+  D  
Sbjct: 1008 SVSQHRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNS--DPS 1065

Query: 700  HRILLLSIKCGGVGLNLIGGNTL 768
              +LLL+   GG+GLNL G +T+
Sbjct: 1066 IDVLLLTTMVGGLGLNLTGADTV 1088


>BT001892-1|AAN71681.1|  673|Drosophila melanogaster SD16865p
           protein.
          Length = 673

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 3/83 (3%)
 Frame = +1

Query: 529 NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQ 699
           + S  + ++  Q    L I E    ++++ ++ Y    G +    R      FN+  D  
Sbjct: 460 SVSQHRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNS--DPS 517

Query: 700 HRILLLSIKCGGVGLNLIGGNTL 768
             +LLL+   GG+GLNL G +T+
Sbjct: 518 IDVLLLTTMVGGLGLNLTGADTV 540


>AF033104-1|AAB95091.3| 1924|Drosophila melanogaster 89B helicase
            protein.
          Length = 1924

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 3/83 (3%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQ 699
            + S  + ++  Q    L I E    ++++ ++ Y    G +    R      FN+  D  
Sbjct: 1711 SVSQHRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNS--DPS 1768

Query: 700  HRILLLSIKCGGVGLNLIGGNTL 768
              +LLL+   GG+GLNL G +T+
Sbjct: 1769 IDVLLLTTMVGGLGLNLTGADTV 1791


>AE014297-2129|AAF55260.2| 1929|Drosophila melanogaster CG4261-PA
            protein.
          Length = 1929

 Score = 31.5 bits (68), Expect = 1.4
 Identities = 22/83 (26%), Positives = 39/83 (46%), Gaps = 3/83 (3%)
 Frame = +1

Query: 529  NTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYT---GQLKVEDRILAETTFNNAADTQ 699
            + S  + ++  Q    L I E    ++++ ++ Y    G +    R      FN+  D  
Sbjct: 1716 SVSQHRALIFCQLKAMLDIVEQDLLRRHLPSVTYLRLDGSVPASQRQDIVNNFNS--DPS 1773

Query: 700  HRILLLSIKCGGVGLNLIGGNTL 768
              +LLL+   GG+GLNL G +T+
Sbjct: 1774 IDVLLLTTMVGGLGLNLTGADTV 1796


>AE013599-3816|AAF47165.3| 1669|Drosophila melanogaster CG4049-PA
            protein.
          Length = 1669

 Score = 30.3 bits (65), Expect = 3.1
 Identities = 23/85 (27%), Positives = 39/85 (45%), Gaps = 11/85 (12%)
 Frame = +1

Query: 541  DKIILVSQWVEYLKIFENFFKQ-----------KNIATLMYTGQLKVEDRILAETTFNNA 687
            D+I+L SQ +  L + E + K            KN +     G    ++R      FN  
Sbjct: 978  DRILLFSQSLLTLNLLEVYLKSSYVPGSNQLWTKNSSYFRLDGSTSSQERERLVNEFN-- 1035

Query: 688  ADTQHRILLLSIKCGGVGLNLIGGN 762
            A++  ++ L+S + G +G+NL G N
Sbjct: 1036 ANSNVKLFLISTRAGSLGINLTGAN 1060


>U59923-1|AAC47469.1| 1714|Drosophila melanogaster
            glutamyl-prolyl-tRNA synthetase protein.
          Length = 1714

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/59 (25%), Positives = 30/59 (50%)
 Frame = +1

Query: 517  DDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            + +LN + + +   ++ V     F  F +QKNI    + G++  ED+I A++     A+
Sbjct: 1610 ESMLNKAQEDMTSHTKKVTNWTDFCGFLEQKNILLAPFCGEISCEDKIKADSARGEEAE 1668


>M74104-1|AAA28594.1| 1714|Drosophila melanogaster transfer
            RNA-Glu-Pro aminoacylsynthetase protein.
          Length = 1714

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/59 (25%), Positives = 30/59 (50%)
 Frame = +1

Query: 517  DDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            + +LN + + +   ++ V     F  F +QKNI    + G++  ED+I A++     A+
Sbjct: 1610 ESMLNKAQEDMTSHTKKVTNWTDFCGFLEQKNILLAPFCGEISCEDKIKADSARGEEAE 1668


>BT001645-1|AAN71400.1|  998|Drosophila melanogaster RE41560p protein.
          Length = 998

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/59 (25%), Positives = 30/59 (50%)
 Frame = +1

Query: 517  DDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            + +LN + + +   ++ V     F  F +QKNI    + G++  ED+I A++     A+
Sbjct: 894  ESMLNKAQEDMTSHTKKVTNWTDFCGFLEQKNILLAPFCGEISCEDKIKADSARGEEAE 952


>AY665384-1|AAT76551.1|  514|Drosophila melanogaster CG4928 protein.
          Length = 514

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = -2

Query: 551 IILSSLVFKMSSTK*ALVCTCCSYNPF*NSRLFPKDFYRAWP 426
           I L +L+ +  + K  LVC+   Y P+   +LFP+ FY   P
Sbjct: 84  IFLPTLIIRKLTVKWTLVCSMLCYAPYIAFQLFPR-FYTLVP 124


>AY058703-1|AAL13932.1| 1714|Drosophila melanogaster LD42739p protein.
          Length = 1714

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/59 (25%), Positives = 30/59 (50%)
 Frame = +1

Query: 517  DDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            + +LN + + +   ++ V     F  F +QKNI    + G++  ED+I A++     A+
Sbjct: 1610 ESMLNKAQEDMTSHTKKVTNWTDFCGFLEQKNILLAPFCGEISCEDKIKADSARGEEAE 1668


>AF145657-1|AAD38632.1|  538|Drosophila melanogaster BcDNA.GH10120
           protein.
          Length = 538

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = -2

Query: 551 IILSSLVFKMSSTK*ALVCTCCSYNPF*NSRLFPKDFYRAWP 426
           I L +L+ +  + K  LVC+   Y P+   +LFP+ FY   P
Sbjct: 93  IFLPTLIIRKLTVKWTLVCSMLCYAPYIAFQLFPR-FYTLVP 133


>AE014298-2503|AAF48682.1|  538|Drosophila melanogaster CG4928-PB,
           isoform B protein.
          Length = 538

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = -2

Query: 551 IILSSLVFKMSSTK*ALVCTCCSYNPF*NSRLFPKDFYRAWP 426
           I L +L+ +  + K  LVC+   Y P+   +LFP+ FY   P
Sbjct: 93  IFLPTLIIRKLTVKWTLVCSMLCYAPYIAFQLFPR-FYTLVP 133


>AE014298-2502|AAN09429.1|  538|Drosophila melanogaster CG4928-PA,
           isoform A protein.
          Length = 538

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/42 (35%), Positives = 23/42 (54%)
 Frame = -2

Query: 551 IILSSLVFKMSSTK*ALVCTCCSYNPF*NSRLFPKDFYRAWP 426
           I L +L+ +  + K  LVC+   Y P+   +LFP+ FY   P
Sbjct: 93  IFLPTLIIRKLTVKWTLVCSMLCYAPYIAFQLFPR-FYTLVP 133


>AE014297-3421|AAN13964.1|  996|Drosophila melanogaster CG5394-PB,
            isoform B protein.
          Length = 996

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/59 (25%), Positives = 30/59 (50%)
 Frame = +1

Query: 517  DDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            + +LN + + +   ++ V     F  F +QKNI    + G++  ED+I A++     A+
Sbjct: 892  ESMLNKAQEDMTSHTKKVTNWTDFCGFLEQKNILLAPFCGEISCEDKIKADSARGEEAE 950


>AE014297-3420|AAF56211.1| 1714|Drosophila melanogaster CG5394-PA,
            isoform A protein.
          Length = 1714

 Score = 29.1 bits (62), Expect = 7.2
 Identities = 15/59 (25%), Positives = 30/59 (50%)
 Frame = +1

Query: 517  DDILNTSDDKIILVSQWVEYLKIFENFFKQKNIATLMYTGQLKVEDRILAETTFNNAAD 693
            + +LN + + +   ++ V     F  F +QKNI    + G++  ED+I A++     A+
Sbjct: 1610 ESMLNKAQEDMTSHTKKVTNWTDFCGFLEQKNILLAPFCGEISCEDKIKADSARGEEAE 1668


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,130,823
Number of Sequences: 53049
Number of extensions: 723860
Number of successful extensions: 2293
Number of sequences better than 10.0: 66
Number of HSP's better than 10.0 without gapping: 2106
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2270
length of database: 24,988,368
effective HSP length: 84
effective length of database: 20,532,252
effective search space used: 3654740856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -