SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/09/19
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120017.Seq
         (731 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

L27467-1|AAB59187.1| 1698|Drosophila melanogaster cora protein.        33   0.30 
AE013599-2840|AAF57592.1| 1698|Drosophila melanogaster CG11949-P...    33   0.30 
AE014296-2897|AAF49349.4|  926|Drosophila melanogaster CG13731-P...    32   0.70 
AF069997-1|AAC62234.1| 1027|Drosophila melanogaster CLOCK protein.     32   0.93 
AF067207-1|AAD10630.1| 1023|Drosophila melanogaster CLOCK protein.     32   0.93 
AF065133-1|AAC39101.1| 1015|Drosophila melanogaster CLOCK protein.     32   0.93 
AE014296-1322|AAX52754.1|  961|Drosophila melanogaster CG7391-PF...    32   0.93 
AE014296-1321|AAX52753.1| 1027|Drosophila melanogaster CG7391-PD...    32   0.93 
AE014296-1320|AAS65057.1| 1027|Drosophila melanogaster CG7391-PC...    32   0.93 
AE014296-1319|AAN12019.1| 1023|Drosophila melanogaster CG7391-PB...    32   0.93 
AE014296-1318|AAF50516.1| 1023|Drosophila melanogaster CG7391-PA...    32   0.93 
BT024209-1|ABC86271.1|  480|Drosophila melanogaster RE32713p pro...    31   1.2  
AY217746-1|AAP45004.1|  480|Drosophila melanogaster peptide rece...    31   1.2  
AE014298-1473|AAF46608.1| 2090|Drosophila melanogaster CG9817-PA...    31   1.2  
AE014296-1651|AAF50277.2|  349|Drosophila melanogaster CG3982-PA...    31   1.2  
BT012663-1|AAT08469.1| 1057|Drosophila melanogaster RE66582p pro...    31   1.6  
AE014298-1107|AAF46312.3| 2038|Drosophila melanogaster CG2252-PB...    31   1.6  
AE014296-1456|AAF50415.2| 1039|Drosophila melanogaster CG7015-PA...    31   1.6  
AY118689-1|AAM50549.1|  893|Drosophila melanogaster AT15637p pro...    31   2.1  
AE014296-1152|AAS65070.1| 1833|Drosophila melanogaster CG10107-P...    31   2.1  
AE014296-1151|AAF50646.3| 1833|Drosophila melanogaster CG10107-P...    31   2.1  
AE013599-3102|AAM68188.1|  889|Drosophila melanogaster CG10543-P...    31   2.1  
AE013599-3101|AAO41340.1| 1024|Drosophila melanogaster CG10543-P...    31   2.1  
AE013599-3100|AAF46652.3| 1634|Drosophila melanogaster CG10543-P...    31   2.1  
AE014298-577|AAF45906.1|  442|Drosophila melanogaster CG15240-PA...    30   2.8  
AE013599-260|AAS64790.2| 1998|Drosophila melanogaster CG33558-PA...    30   2.8  
AY102651-1|AAM27480.1|  602|Drosophila melanogaster GH01517p pro...    30   3.7  
AF145634-1|AAD38609.1|  696|Drosophila melanogaster BcDNA.GH0619...    30   3.7  
AE014297-1927|AAF55121.3|  602|Drosophila melanogaster CG33485-P...    30   3.7  
AE014296-517|AAF47693.2|  753|Drosophila melanogaster CG9973-PA ...    30   3.7  
AE013599-1752|AAF58349.1|  717|Drosophila melanogaster CG6191-PA...    30   3.7  
AE013599-1365|AAF58603.2| 1025|Drosophila melanogaster CG13188-P...    30   3.7  
U67935-1|AAC47293.1|  622|Drosophila melanogaster epidermal grow...    29   4.9  
BT029281-1|ABK30918.1|  587|Drosophila melanogaster IP15007p pro...    29   4.9  
BT001649-1|AAN71404.1|  601|Drosophila melanogaster RE43755p pro...    29   4.9  
BT001369-1|AAN71124.1|  347|Drosophila melanogaster AT30804p pro...    29   4.9  
AY119006-1|AAM50866.1|  445|Drosophila melanogaster LP03361p pro...    29   4.9  
AY095529-1|AAM12260.1|  935|Drosophila melanogaster RE23942p pro...    29   4.9  
AY051895-1|AAK93319.1|  743|Drosophila melanogaster LD38452p pro...    29   4.9  
AE014298-2820|AAF48937.2|  935|Drosophila melanogaster CG7884-PA...    29   4.9  
AE014298-960|AAF46204.1|  601|Drosophila melanogaster CG3075-PA ...    29   4.9  
AE014297-385|ABI31142.1| 1689|Drosophila melanogaster CG34113-PO...    29   4.9  
AE014296-2557|AAF49596.1|  445|Drosophila melanogaster CG7604-PA...    29   4.9  
AE014296-1713|AAF50220.2| 1473|Drosophila melanogaster CG16711-P...    29   4.9  
AE014296-1020|AAX52759.1|  623|Drosophila melanogaster CG10491-P...    29   4.9  
AE014296-1019|AAF50739.2|  623|Drosophila melanogaster CG10491-P...    29   4.9  
AE014296-570|AAN11533.1|  743|Drosophila melanogaster CG11494-PB...    29   4.9  
AE014296-569|AAF47721.2|  743|Drosophila melanogaster CG11494-PA...    29   4.9  
BT025074-1|ABE73245.1|  325|Drosophila melanogaster IP15289p pro...    29   6.5  
BT023778-1|AAZ41787.1| 2016|Drosophila melanogaster LD21067p pro...    29   6.5  
BT016095-1|AAV36980.1|  407|Drosophila melanogaster LD35426p pro...    29   6.5  
BT003479-1|AAO39482.1|  937|Drosophila melanogaster RE59328p pro...    29   6.5  
BT001323-1|AAN71078.1|  495|Drosophila melanogaster AT16616p pro...    29   6.5  
AY682915-1|AAT81589.1| 1473|Drosophila melanogaster myocardin-re...    29   6.5  
AY128444-1|AAM75037.1| 1332|Drosophila melanogaster LD21041p pro...    29   6.5  
AY075585-1|AAL68389.1| 1043|Drosophila melanogaster SD09488p pro...    29   6.5  
AY058702-1|AAL13931.1|  407|Drosophila melanogaster LD42420p pro...    29   6.5  
AY052367-1|AAL14775.1|  789|Drosophila melanogaster hephaestus p...    29   6.5  
AE014297-4833|AAO41627.1|  789|Drosophila melanogaster CG31000-P...    29   6.5  
AE014297-3192|AAF56027.3| 1346|Drosophila melanogaster CG31158-P...    29   6.5  
AE014297-3191|AAO41590.1| 1480|Drosophila melanogaster CG31158-P...    29   6.5  
AE014296-687|AAF47791.2|  937|Drosophila melanogaster CG32264-PA...    29   6.5  
AE014296-506|AAF47681.2| 1473|Drosophila melanogaster CG32296-PA...    29   6.5  
AE014296-123|AAN11448.1|  581|Drosophila melanogaster CG17129-PC...    29   6.5  
AE014296-122|AAN11447.1|  581|Drosophila melanogaster CG17129-PB...    29   6.5  
AE014296-121|AAF47402.2|  581|Drosophila melanogaster CG17129-PA...    29   6.5  
AE014134-1407|AAF52607.1| 2016|Drosophila melanogaster CG8552-PA...    29   6.5  
AE013599-2620|AAF57748.2| 1043|Drosophila melanogaster CG5109-PA...    29   6.5  
X00854-2|CAA25408.1|  413|Drosophila melanogaster ftz protein pr...    29   8.6  
DQ138938-1|ABA86544.1| 1374|Drosophila melanogaster CG8896 protein.    29   8.6  
AY325814-1|AAP88969.1|  509|Drosophila melanogaster traffic jam ...    29   8.6  
AJ131022-1|CAB55429.1|  523|Drosophila melanogaster C2H2 zinc fi...    29   8.6  
AE014298-1804|AAF48196.2| 3604|Drosophila melanogaster CG4013-PC...    29   8.6  
AE014298-1803|AAN09315.1| 3604|Drosophila melanogaster CG4013-PB...    29   8.6  
AE014298-1802|AAF48195.2| 3604|Drosophila melanogaster CG4013-PA...    29   8.6  
AE014296-2343|AAF49771.3| 2294|Drosophila melanogaster CG32133-P...    29   8.6  
AE014134-3104|AAF53804.2|  509|Drosophila melanogaster CG10034-P...    29   8.6  

>L27467-1|AAB59187.1| 1698|Drosophila melanogaster cora protein.
          Length = 1698

 Score = 33.5 bits (73), Expect = 0.30
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +1

Query: 1   SMTDERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRD 144
           S +  +G   Y++  P    P +  TA F  +Q YN  PGYV P+  D
Sbjct: 685 SYSPTKGPQGYSSGAPGSYKPISDPTADFLESQRYNKEPGYVGPSKAD 732


>AE013599-2840|AAF57592.1| 1698|Drosophila melanogaster CG11949-PA,
           isoform A protein.
          Length = 1698

 Score = 33.5 bits (73), Expect = 0.30
 Identities = 17/48 (35%), Positives = 24/48 (50%)
 Frame = +1

Query: 1   SMTDERGNFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRD 144
           S +  +G   Y++  P    P +  TA F  +Q YN  PGYV P+  D
Sbjct: 685 SYSPTKGPQGYSSGAPGSYKPISDPTADFLESQRYNKEPGYVGPSKAD 732


>AE014296-2897|AAF49349.4|  926|Drosophila melanogaster CG13731-PA
           protein.
          Length = 926

 Score = 32.3 bits (70), Expect = 0.70
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = +1

Query: 43  PPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTR 141
           PPP R P+ P T   T  +    AP Y+PPT +
Sbjct: 455 PPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNK 487



 Score = 32.3 bits (70), Expect = 0.70
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = +1

Query: 43  PPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTR 141
           PPP R P+ P T   T  +    AP Y+PPT +
Sbjct: 666 PPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNK 698



 Score = 32.3 bits (70), Expect = 0.70
 Identities = 14/33 (42%), Positives = 18/33 (54%)
 Frame = +1

Query: 43  PPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTR 141
           PPP R P+ P T   T  +    AP Y+PPT +
Sbjct: 769 PPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNK 801



 Score = 28.7 bits (61), Expect = 8.6
 Identities = 21/64 (32%), Positives = 26/64 (40%), Gaps = 4/64 (6%)
 Frame = +1

Query: 40  PPPPLRYPSNPATAIF---TNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNS-VAIAPYNK 207
           PPPP R P+ P T      T   T    P   PPT       T+R  +T +   + P NK
Sbjct: 428 PPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNK 487

Query: 208 SKEP 219
              P
Sbjct: 488 PLPP 491



 Score = 28.7 bits (61), Expect = 8.6
 Identities = 21/64 (32%), Positives = 26/64 (40%), Gaps = 4/64 (6%)
 Frame = +1

Query: 40  PPPPLRYPSNPATAIF---TNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNS-VAIAPYNK 207
           PPPP R P+ P T      T   T    P   PPT       T+R  +T +   + P NK
Sbjct: 639 PPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNK 698

Query: 208 SKEP 219
              P
Sbjct: 699 PLPP 702



 Score = 28.7 bits (61), Expect = 8.6
 Identities = 21/64 (32%), Positives = 26/64 (40%), Gaps = 4/64 (6%)
 Frame = +1

Query: 40  PPPPLRYPSNPATAIF---TNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNS-VAIAPYNK 207
           PPPP R P+ P T      T   T    P   PPT       T+R  +T +   + P NK
Sbjct: 742 PPPPTRPPTKPPTTYLPPVTVRTTRATPPPTRPPTRPPTYPPTTRRLTTPAPTYLPPTNK 801

Query: 208 SKEP 219
              P
Sbjct: 802 PLPP 805


>AF069997-1|AAC62234.1| 1027|Drosophila melanogaster CLOCK protein.
          Length = 1027

 Score = 31.9 bits (69), Expect = 0.93
 Identities = 17/67 (25%), Positives = 32/67 (47%)
 Frame = +3

Query: 75  NGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           N H   + NLQQ+ +  +      Q  H+ QQQ +    +  QQ+Q+   ++++    QQ
Sbjct: 774 NLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 833

Query: 255 CVDFVQK 275
            +   Q+
Sbjct: 834 QLQLQQQ 840


>AF067207-1|AAD10630.1| 1023|Drosophila melanogaster CLOCK protein.
          Length = 1023

 Score = 31.9 bits (69), Expect = 0.93
 Identities = 17/67 (25%), Positives = 32/67 (47%)
 Frame = +3

Query: 75  NGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           N H   + NLQQ+ +  +      Q  H+ QQQ +    +  QQ+Q+   ++++    QQ
Sbjct: 770 NLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 829

Query: 255 CVDFVQK 275
            +   Q+
Sbjct: 830 QLQLQQQ 836


>AF065133-1|AAC39101.1| 1015|Drosophila melanogaster CLOCK protein.
          Length = 1015

 Score = 31.9 bits (69), Expect = 0.93
 Identities = 17/60 (28%), Positives = 31/60 (51%)
 Frame = +3

Query: 75  NGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           N H   + NLQQ+ +  +      Q  H+ QQQ +    +  QQ+Q+   +++++ L QQ
Sbjct: 770 NLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQ-QQQQQQQQQQQQQQQQQQLQLQQQ 828


>AE014296-1322|AAX52754.1|  961|Drosophila melanogaster CG7391-PF,
           isoform F protein.
          Length = 961

 Score = 31.9 bits (69), Expect = 0.93
 Identities = 17/67 (25%), Positives = 32/67 (47%)
 Frame = +3

Query: 75  NGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           N H   + NLQQ+ +  +      Q  H+ QQQ +    +  QQ+Q+   ++++    QQ
Sbjct: 708 NLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 767

Query: 255 CVDFVQK 275
            +   Q+
Sbjct: 768 QLQLQQQ 774


>AE014296-1321|AAX52753.1| 1027|Drosophila melanogaster CG7391-PD,
           isoform D protein.
          Length = 1027

 Score = 31.9 bits (69), Expect = 0.93
 Identities = 17/67 (25%), Positives = 32/67 (47%)
 Frame = +3

Query: 75  NGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           N H   + NLQQ+ +  +      Q  H+ QQQ +    +  QQ+Q+   ++++    QQ
Sbjct: 774 NLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 833

Query: 255 CVDFVQK 275
            +   Q+
Sbjct: 834 QLQLQQQ 840


>AE014296-1320|AAS65057.1| 1027|Drosophila melanogaster CG7391-PC,
           isoform C protein.
          Length = 1027

 Score = 31.9 bits (69), Expect = 0.93
 Identities = 17/67 (25%), Positives = 32/67 (47%)
 Frame = +3

Query: 75  NGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           N H   + NLQQ+ +  +      Q  H+ QQQ +    +  QQ+Q+   ++++    QQ
Sbjct: 774 NLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 833

Query: 255 CVDFVQK 275
            +   Q+
Sbjct: 834 QLQLQQQ 840


>AE014296-1319|AAN12019.1| 1023|Drosophila melanogaster CG7391-PB,
           isoform B protein.
          Length = 1023

 Score = 31.9 bits (69), Expect = 0.93
 Identities = 17/67 (25%), Positives = 32/67 (47%)
 Frame = +3

Query: 75  NGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           N H   + NLQQ+ +  +      Q  H+ QQQ +    +  QQ+Q+   ++++    QQ
Sbjct: 770 NLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 829

Query: 255 CVDFVQK 275
            +   Q+
Sbjct: 830 QLQLQQQ 836


>AE014296-1318|AAF50516.1| 1023|Drosophila melanogaster CG7391-PA,
           isoform A protein.
          Length = 1023

 Score = 31.9 bits (69), Expect = 0.93
 Identities = 17/67 (25%), Positives = 32/67 (47%)
 Frame = +3

Query: 75  NGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           N H   + NLQQ+ +  +      Q  H+ QQQ +    +  QQ+Q+   ++++    QQ
Sbjct: 770 NLHTQHQHNLQQQHQSHSQLQQHTQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ 829

Query: 255 CVDFVQK 275
            +   Q+
Sbjct: 830 QLQLQQQ 836


>BT024209-1|ABC86271.1|  480|Drosophila melanogaster RE32713p
           protein.
          Length = 480

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 21/98 (21%), Positives = 46/98 (46%)
 Frame = +3

Query: 117 RVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVDFVQKIIRYYRC 296
           R+ A+   ++  G  P  QH + + +T  QEQ+  +++ +I   Q   +  QK  R  + 
Sbjct: 291 RLSASLKRQKSTGTHPSGQHNVANRQTDDQEQQQQSQQHQINNCQHHCEITQKPAR-RKV 349

Query: 297 NDMSELSPLMIHFINTIRDMCIDTNPINVNVVKRFESE 410
            + S+L    +  I +   +C++     + +   +E+E
Sbjct: 350 QNSSQLKVTKMLLIVSTVFVCLNLPSCLLRIEAYWETE 387


>AY217746-1|AAP45004.1|  480|Drosophila melanogaster peptide
           receptor GPCR protein.
          Length = 480

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 21/98 (21%), Positives = 46/98 (46%)
 Frame = +3

Query: 117 RVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVDFVQKIIRYYRC 296
           R+ A+   ++  G  P  QH + + +T  QEQ+  +++ +I   Q   +  QK  R  + 
Sbjct: 291 RLSASLKRQKSTGTHPSGQHNVANRQTDDQEQQQQSQQHQINNCQHHCEITQKPAR-RKV 349

Query: 297 NDMSELSPLMIHFINTIRDMCIDTNPINVNVVKRFESE 410
            + S+L    +  I +   +C++     + +   +E+E
Sbjct: 350 QNSSQLKVTKMLLIVSTVFVCLNLPSCLLRIEAYWETE 387


>AE014298-1473|AAF46608.1| 2090|Drosophila melanogaster CG9817-PA
            protein.
          Length = 2090

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 13/45 (28%), Positives = 24/45 (53%)
 Frame = +3

Query: 81   HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
            H+HQ+   QQ+ + ++ +  + Q  H  Q QH+    +  QQ Q+
Sbjct: 947  HLHQQQQQQQQQQQQSQHQQQHQQQHAQQLQHQQLQQQHAQQHQQ 991


>AE014296-1651|AAF50277.2|  349|Drosophila melanogaster CG3982-PA
           protein.
          Length = 349

 Score = 31.5 bits (68), Expect = 1.2
 Identities = 14/47 (29%), Positives = 24/47 (51%)
 Frame = +3

Query: 69  SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQE 209
           SG  H+HQ+    Q+ +++       Q G+E QQQ  +  D  +Q +
Sbjct: 203 SGRAHVHQQQVPHQQQQMQHQQQMPPQTGYEQQQQQVIQPDAQMQNK 249


>BT012663-1|AAT08469.1| 1057|Drosophila melanogaster RE66582p
           protein.
          Length = 1057

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHEPQQQHK 179
           H HQ+ ++QQ+ + +      QQ  H+ QQQH+
Sbjct: 85  HQHQQQHMQQQQQQQQHQQQHQQQQHQQQQQHQ 117


>AE014298-1107|AAF46312.3| 2038|Drosophila melanogaster CG2252-PB,
            isoform B protein.
          Length = 2038

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 17/62 (27%), Positives = 31/62 (50%)
 Frame = +3

Query: 90   QRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQCVDFV 269
            Q+  +QQ    +  +  +QQ  H+ QQQH+    +  QQ+Q T  + ++    QQ    +
Sbjct: 1498 QQQQMQQMQLQQQHHQQQQQQTHQQQQQHQQQHHQQQQQQQLTQQQLQQQQQQQQQQQHL 1557

Query: 270  QK 275
            Q+
Sbjct: 1558 QQ 1559



 Score = 29.5 bits (63), Expect = 4.9
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +3

Query: 84   IHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
            + Q+ + QQ+ +        QQ  H+ QQQ +L   +  QQ+Q+
Sbjct: 1507 LQQQHHQQQQQQTHQQQQQHQQQHHQQQQQQQLTQQQLQQQQQQ 1550


>AE014296-1456|AAF50415.2| 1039|Drosophila melanogaster CG7015-PA
           protein.
          Length = 1039

 Score = 31.1 bits (67), Expect = 1.6
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHEPQQQHK 179
           H HQ+ ++QQ+ + +      QQ  H+ QQQH+
Sbjct: 85  HQHQQQHMQQQQQQQQHQQQHQQQQHQQQQQHQ 117


>AY118689-1|AAM50549.1|  893|Drosophila melanogaster AT15637p
           protein.
          Length = 893

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 7/68 (10%)
 Frame = +3

Query: 81  HIH-QRANLQQRARVRAAYDARQQNGHEPQQQH-KLGSDRTV-----QQEQRTDARRRRI 239
           H H QR+ L      +      QQ  H PQ QH +L S +       QQ+Q+   ++++ 
Sbjct: 516 HRHNQRSPLHHHPAAQQLQQQHQQPSHSPQHQHARLQSPQPAPVQQQQQQQQQQQQQQQQ 575

Query: 240 YLVQQCVD 263
           +L QQ  D
Sbjct: 576 FLQQQAAD 583


>AE014296-1152|AAS65070.1| 1833|Drosophila melanogaster CG10107-PC,
           isoform C protein.
          Length = 1833

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +3

Query: 21  QFLLQHPSAAAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTV 200
           Q+     SAA    +  G+   HQ+   QQ+ + +     +QQ   +PQQQH+    + V
Sbjct: 54  QYQQPQQSAAPTYHIIGGDDLAHQQQQHQQQQQQQ---QQQQQQQQQPQQQHQQQQQQVV 110

Query: 201 QQEQRTDARR-RRIYLVQQ 254
              Q+   ++ ++++  QQ
Sbjct: 111 MHHQQHQVQQVQQVHYQQQ 129


>AE014296-1151|AAF50646.3| 1833|Drosophila melanogaster CG10107-PA,
           isoform A protein.
          Length = 1833

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +3

Query: 21  QFLLQHPSAAAEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTV 200
           Q+     SAA    +  G+   HQ+   QQ+ + +     +QQ   +PQQQH+    + V
Sbjct: 54  QYQQPQQSAAPTYHIIGGDDLAHQQQQHQQQQQQQ---QQQQQQQQQPQQQHQQQQQQVV 110

Query: 201 QQEQRTDARR-RRIYLVQQ 254
              Q+   ++ ++++  QQ
Sbjct: 111 MHHQQHQVQQVQQVHYQQQ 129


>AE013599-3102|AAM68188.1|  889|Drosophila melanogaster CG10543-PB,
           isoform B protein.
          Length = 889

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 7/68 (10%)
 Frame = +3

Query: 81  HIH-QRANLQQRARVRAAYDARQQNGHEPQQQH-KLGSDRTV-----QQEQRTDARRRRI 239
           H H QR+ L      +      QQ  H PQ QH +L S +       QQ+Q+   ++++ 
Sbjct: 516 HRHNQRSPLHHHPAAQQLQQQHQQPSHSPQHQHARLQSPQPAPVQQQQQQQQQQQQQQQQ 575

Query: 240 YLVQQCVD 263
           +L QQ  D
Sbjct: 576 FLQQQAAD 583


>AE013599-3101|AAO41340.1| 1024|Drosophila melanogaster CG10543-PC,
           isoform C protein.
          Length = 1024

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 7/68 (10%)
 Frame = +3

Query: 81  HIH-QRANLQQRARVRAAYDARQQNGHEPQQQH-KLGSDRTV-----QQEQRTDARRRRI 239
           H H QR+ L      +      QQ  H PQ QH +L S +       QQ+Q+   ++++ 
Sbjct: 651 HRHNQRSPLHHHPAAQQLQQQHQQPSHSPQHQHARLQSPQPAPVQQQQQQQQQQQQQQQQ 710

Query: 240 YLVQQCVD 263
           +L QQ  D
Sbjct: 711 FLQQQAAD 718


>AE013599-3100|AAF46652.3| 1634|Drosophila melanogaster CG10543-PA,
            isoform A protein.
          Length = 1634

 Score = 30.7 bits (66), Expect = 2.1
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 7/68 (10%)
 Frame = +3

Query: 81   HIH-QRANLQQRARVRAAYDARQQNGHEPQQQH-KLGSDRTV-----QQEQRTDARRRRI 239
            H H QR+ L      +      QQ  H PQ QH +L S +       QQ+Q+   ++++ 
Sbjct: 1261 HRHNQRSPLHHHPAAQQLQQQHQQPSHSPQHQHARLQSPQPAPVQQQQQQQQQQQQQQQQ 1320

Query: 240  YLVQQCVD 263
            +L QQ  D
Sbjct: 1321 FLQQQAAD 1328


>AE014298-577|AAF45906.1|  442|Drosophila melanogaster CG15240-PA
           protein.
          Length = 442

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 13/45 (28%), Positives = 23/45 (51%)
 Frame = +3

Query: 108 QRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIY 242
           +R R    Y  + QN H   QQ +    +  QQ+Q   A+++R++
Sbjct: 84  RRGRTERQYQQQIQNHHHHHQQQQQQQQQHQQQQQHQGAQQQRVF 128


>AE013599-260|AAS64790.2| 1998|Drosophila melanogaster CG33558-PA
            protein.
          Length = 1998

 Score = 30.3 bits (65), Expect = 2.8
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 3/71 (4%)
 Frame = +3

Query: 51   AEVSL*SGNGHIHQRANL---QQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTD 221
            A + + +GNGH+ QR  L   QQ+ R        +Q  H+ QQ+ +    +  Q +QR  
Sbjct: 1784 AGMGIGNGNGHLGQRPQLPLPQQKLRAAQQQHLAEQQ-HQQQQEQQQHHQQHQQHQQRQP 1842

Query: 222  ARRRRIYLVQQ 254
                R   VQQ
Sbjct: 1843 PIPSRHSSVQQ 1853


>AY102651-1|AAM27480.1|  602|Drosophila melanogaster GH01517p
           protein.
          Length = 602

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQ 173
           HQR NL+QRA   A   AR+Q  H  Q +
Sbjct: 13  HQRTNLRQRAAAVATSKARRQRQHHLQPE 41


>AF145634-1|AAD38609.1|  696|Drosophila melanogaster BcDNA.GH06193
           protein.
          Length = 696

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +3

Query: 51  AEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
           + + L SG  H H + +  QR+   A +   Q+  H  QQQ +     T QQ+Q+
Sbjct: 51  SSLGLGSGGFHPHYQQHHHQRSH-SATHHNHQKRHHTQQQQQQQQQQHTQQQQQQ 104


>AE014297-1927|AAF55121.3|  602|Drosophila melanogaster CG33485-PA
           protein.
          Length = 602

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 14/29 (48%), Positives = 17/29 (58%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQ 173
           HQR NL+QRA   A   AR+Q  H  Q +
Sbjct: 13  HQRTNLRQRAAAVATSKARRQRQHHLQPE 41


>AE014296-517|AAF47693.2|  753|Drosophila melanogaster CG9973-PA
           protein.
          Length = 753

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 14/47 (29%), Positives = 22/47 (46%)
 Frame = +3

Query: 75  NGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
           + H H   + QQ    +     +QQ  H  QQQH+    +  QQ+Q+
Sbjct: 60  HSHSHPHHHYQQHYPQQQHLQQQQQQQHHAQQQHQQQQQQQQQQQQQ 106


>AE013599-1752|AAF58349.1|  717|Drosophila melanogaster CG6191-PA
           protein.
          Length = 717

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +3

Query: 51  AEVSL*SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
           + + L SG  H H + +  QR+   A +   Q+  H  QQQ +     T QQ+Q+
Sbjct: 51  SSLGLGSGGFHPHYQQHHHQRSH-SATHHNHQKRHHTQQQQQQQQQQHTQQQQQQ 104


>AE013599-1365|AAF58603.2| 1025|Drosophila melanogaster CG13188-PA,
            isoform A protein.
          Length = 1025

 Score = 29.9 bits (64), Expect = 3.7
 Identities = 17/57 (29%), Positives = 24/57 (42%)
 Frame = +1

Query: 49   PLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKEP 219
            P   P    T    NA   + AP   PPT       TSR + ++  +I  Y K ++P
Sbjct: 956  PTMAPPLATTPAANNATAVSKAPSAPPPTASRTGRSTSRLDISDMESIYGYLKPRKP 1012


>U67935-1|AAC47293.1|  622|Drosophila melanogaster epidermal growth
           factor-like proteinprotein.
          Length = 622

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +3

Query: 78  GHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 233
           GH  Q    ++  R +     ++Q   + Q+QHK G+    QQ+QR   +R+
Sbjct: 260 GHRQQLQQDKRDHRRQRQDQQKEQRQQQQQRQHKSGNKHQQQQQQRRKHQRK 311


>BT029281-1|ABK30918.1|  587|Drosophila melanogaster IP15007p
           protein.
          Length = 587

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +3

Query: 78  GHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 233
           GH  Q    ++  R +     ++Q   + Q+QHK G+    QQ+QR   +R+
Sbjct: 230 GHRQQLQQDKRDHRRQRQDQQKEQRQQQQQRQHKSGNKHQQQQQQRRKHQRK 281


>BT001649-1|AAN71404.1|  601|Drosophila melanogaster RE43755p
           protein.
          Length = 601

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = +3

Query: 132 YDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           + A+ Q   + QQQH     +  QQ+Q   A  +++ ++QQ
Sbjct: 324 FSAQLQQQQQQQQQHAAQQQQQQQQQQHHQAHPQQVQIIQQ 364


>BT001369-1|AAN71124.1|  347|Drosophila melanogaster AT30804p
           protein.
          Length = 347

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 15/62 (24%), Positives = 30/62 (48%)
 Frame = +3

Query: 69  SGNGHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLV 248
           SG  H+HQ+    Q+ +++       Q G+E QQQ ++       Q +  + ++++  L 
Sbjct: 200 SGRAHVHQQQVPHQQQQMQHQQQMPPQTGYEQQQQQQVIQPDAQMQNKYANQQQQQHQLQ 259

Query: 249 QQ 254
            Q
Sbjct: 260 PQ 261


>AY119006-1|AAM50866.1|  445|Drosophila melanogaster LP03361p
           protein.
          Length = 445

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 3/40 (7%)
 Frame = -3

Query: 516 STKMPEIYSNRSAGTRPR---CLVPTLFATESGGVSWSPP 406
           +TK P+  S + +G  P      +PT   T  G VSW+PP
Sbjct: 333 TTKKPDECSTKPSGWNPGGPIVTIPTTSRTPCGCVSWNPP 372


>AY095529-1|AAM12260.1|  935|Drosophila melanogaster RE23942p
           protein.
          Length = 935

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           H  Q+  +QQ+         +QQ  H PQQQ +L      QQ+Q+   ++   + +QQ
Sbjct: 172 HHAQQLQVQQQQLQHIPQQKQQQPHHIPQQQQQLQHIPQQQQQQQPVPQQHATWQLQQ 229


>AY051895-1|AAK93319.1|  743|Drosophila melanogaster LD38452p
           protein.
          Length = 743

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +3

Query: 105 QQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           QQ+ + +A   A+QQ+ H  QQQ      +  QQ+Q+        +  QQ
Sbjct: 177 QQQQQQQAQQQAQQQHHHHQQQQQLQQQQQQAQQQQQQQQHHHHHHQQQQ 226


>AE014298-2820|AAF48937.2|  935|Drosophila melanogaster CG7884-PA
           protein.
          Length = 935

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +3

Query: 81  HIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           H  Q+  +QQ+         +QQ  H PQQQ +L      QQ+Q+   ++   + +QQ
Sbjct: 172 HHAQQLQVQQQQLQHIPQQKQQQPHHIPQQQQQLQHIPQQQQQQQPVPQQHATWQLQQ 229


>AE014298-960|AAF46204.1|  601|Drosophila melanogaster CG3075-PA
           protein.
          Length = 601

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 12/41 (29%), Positives = 22/41 (53%)
 Frame = +3

Query: 132 YDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           + A+ Q   + QQQH     +  QQ+Q   A  +++ ++QQ
Sbjct: 324 FSAQLQQQQQQQQQHAAQQQQQQQQQQHHQAHPQQVQIIQQ 364


>AE014297-385|ABI31142.1| 1689|Drosophila melanogaster CG34113-PO,
           isoform O protein.
          Length = 1689

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 2/70 (2%)
 Frame = +3

Query: 21  QFLLQHPSAAAEVSL*SGNGHIHQRANLQQRARVRAAYDAR--QQNGHEPQQQHKLGSDR 194
           Q   QH  A A  S            + +QR R RA+ D +  QQ  H+ QQQH+L +  
Sbjct: 728 QLQQQHHQATATKSGGDNKPDGSPAKSSKQRMR-RASRDPQIQQQQQHQQQQQHQLHAAT 786

Query: 195 TVQQEQRTDA 224
           ++   QR  A
Sbjct: 787 SITSSQRKQA 796


>AE014296-2557|AAF49596.1|  445|Drosophila melanogaster CG7604-PA
           protein.
          Length = 445

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 3/40 (7%)
 Frame = -3

Query: 516 STKMPEIYSNRSAGTRPR---CLVPTLFATESGGVSWSPP 406
           +TK P+  S + +G  P      +PT   T  G VSW+PP
Sbjct: 333 TTKKPDECSTKPSGWNPGGPIVTIPTTSRTPCGCVSWNPP 372


>AE014296-1713|AAF50220.2| 1473|Drosophila melanogaster CG16711-PA,
            isoform A protein.
          Length = 1473

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 13/43 (30%), Positives = 20/43 (46%)
 Frame = +3

Query: 87   HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQR 215
            H     QQ+   +      QQ  H+ QQQH+    +  QQ+Q+
Sbjct: 1347 HHHQQQQQQQHQQQQQQQHQQQQHQQQQQHQQQQHQQQQQQQK 1389


>AE014296-1020|AAX52759.1|  623|Drosophila melanogaster CG10491-PB,
           isoform B protein.
          Length = 623

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +3

Query: 78  GHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 233
           GH  Q    ++  R +     ++Q   + Q+QHK G+    QQ+QR   +R+
Sbjct: 261 GHRQQLQQDKRDHRRQRQDQQKEQRQQQQQRQHKSGNKHQQQQQQRRKHQRK 312


>AE014296-1019|AAF50739.2|  623|Drosophila melanogaster CG10491-PA,
           isoform A protein.
          Length = 623

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 15/52 (28%), Positives = 26/52 (50%)
 Frame = +3

Query: 78  GHIHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRR 233
           GH  Q    ++  R +     ++Q   + Q+QHK G+    QQ+QR   +R+
Sbjct: 261 GHRQQLQQDKRDHRRQRQDQQKEQRQQQQQRQHKSGNKHQQQQQQRRKHQRK 312


>AE014296-570|AAN11533.1|  743|Drosophila melanogaster CG11494-PB,
           isoform B protein.
          Length = 743

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +3

Query: 105 QQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           QQ+ + +A   A+QQ+ H  QQQ      +  QQ+Q+        +  QQ
Sbjct: 177 QQQQQQQAQQQAQQQHHHHQQQQQLQQQQQQAQQQQQQQQHHHHHHQQQQ 226


>AE014296-569|AAF47721.2|  743|Drosophila melanogaster CG11494-PA,
           isoform A protein.
          Length = 743

 Score = 29.5 bits (63), Expect = 4.9
 Identities = 15/50 (30%), Positives = 24/50 (48%)
 Frame = +3

Query: 105 QQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           QQ+ + +A   A+QQ+ H  QQQ      +  QQ+Q+        +  QQ
Sbjct: 177 QQQQQQQAQQQAQQQHHHHQQQQQLQQQQQQAQQQQQQQQHHHHHHQQQQ 226


>BT025074-1|ABE73245.1|  325|Drosophila melanogaster IP15289p
           protein.
          Length = 325

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +3

Query: 69  SGNGHIHQRANLQQRARVRAAYDARQ--QNGHEPQQQ-----HKLGSDRTVQQEQRTDAR 227
           S + H H   + Q  A   AAY A Q  Q  H+ QQQ     H++ +    QQ+Q+  A+
Sbjct: 38  STHPHPHPHQHPQHSAASAAAYQAMQVHQQQHQQQQQAAVFHHQVAAIAAQQQQQQQQAQ 97

Query: 228 RRRIYLVQQ 254
            +    +QQ
Sbjct: 98  VQHQQQMQQ 106


>BT023778-1|AAZ41787.1| 2016|Drosophila melanogaster LD21067p protein.
          Length = 2016

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 7/80 (8%)
 Frame = +1

Query: 40   PPPPLRYPSNPATAIFTNAQTYNNAPGYVP---PTTRDNKMDTSRSNSTNSVAIAPYNKS 210
            PPPP    S  A++IF      ++AP +VP   P +  +    S+ +ST+S+   P   +
Sbjct: 951  PPPPTG--STTASSIFAAPPVASSAPLFVPVPGPPSVSSLFSPSQVDSTSSLFAPPPTSA 1008

Query: 211  K----EPTLDAGESIWYNNV 258
                  P  D   +++ NN+
Sbjct: 1009 NTTILTPAPDTTSTLFANNI 1028


>BT016095-1|AAV36980.1|  407|Drosophila melanogaster LD35426p
           protein.
          Length = 407

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 20/71 (28%), Positives = 27/71 (38%)
 Frame = +1

Query: 37  TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           +PP P    SNPATA +  +       G +P     ++     S  T SV  + Y     
Sbjct: 223 SPPAPATTSSNPATAPYNASPVSTQPSGLLPAPVFHDENPRPLSVVTTSVINSRYPVDPR 282

Query: 217 PTLDAGESIWY 249
           P      S WY
Sbjct: 283 P----ANSYWY 289


>BT003479-1|AAO39482.1|  937|Drosophila melanogaster RE59328p
           protein.
          Length = 937

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARR 230
           H +  L         + A QQ  H+P QQ +    +TVQQ+Q+   +R
Sbjct: 9   HHQRQLLHHQHSHPPFQATQQ--HQPAQQQQQQQHQTVQQQQQQQQQR 54


>BT001323-1|AAN71078.1|  495|Drosophila melanogaster AT16616p
           protein.
          Length = 495

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 20/71 (28%), Positives = 27/71 (38%)
 Frame = +1

Query: 37  TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           +PP P    SNPATA +  +       G +P     ++     S  T SV  + Y     
Sbjct: 327 SPPAPATTSSNPATAPYNASPVSTQPSGLLPAPVFHDENPRPLSVVTTSVINSRYPVDPR 386

Query: 217 PTLDAGESIWY 249
           P      S WY
Sbjct: 387 P----ANSYWY 393


>AY682915-1|AAT81589.1| 1473|Drosophila melanogaster
           myocardin-related transcriptionfactor protein.
          Length = 1473

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = +3

Query: 84  IHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           + Q+   + + +  AA  A QQ   + QQQ +    + +QQ+Q+   +++++ L+ Q
Sbjct: 817 VKQQLEAKIQKQKAAAAAAAQQQQQQQQQQQQQQQQQALQQQQQQQQQQQQVRLLTQ 873


>AY128444-1|AAM75037.1| 1332|Drosophila melanogaster LD21041p
           protein.
          Length = 1332

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 7/80 (8%)
 Frame = +1

Query: 40  PPPPLRYPSNPATAIFTNAQTYNNAPGYVP---PTTRDNKMDTSRSNSTNSVAIAPYNKS 210
           PPPP    S  A++IF      ++AP +VP   P +  +    S+ +ST+S+   P   +
Sbjct: 267 PPPPTG--STTASSIFAAPPVASSAPLFVPVPGPPSVSSLFSPSQVDSTSSLFAPPPTSA 324

Query: 211 K----EPTLDAGESIWYNNV 258
                 P  D   +++ NN+
Sbjct: 325 NTTILTPAPDTTSTLFANNI 344


>AY075585-1|AAL68389.1| 1043|Drosophila melanogaster SD09488p
           protein.
          Length = 1043

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAP--Y 201
           YY T  P   +P++P+T   TN+    + P   P           ++N+   ++ AP  Y
Sbjct: 71  YYATTGPQTTHPTHPSTIQITNSFAQQSTP---PKQQAATSCSPFKANNIRIISTAPSVY 127

Query: 202 NKSKEP 219
           + +K P
Sbjct: 128 SLNKPP 133


>AY058702-1|AAL13931.1|  407|Drosophila melanogaster LD42420p
           protein.
          Length = 407

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 20/71 (28%), Positives = 27/71 (38%)
 Frame = +1

Query: 37  TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           +PP P    SNPATA +  +       G +P     ++     S  T SV  + Y     
Sbjct: 223 SPPAPATTSSNPATAPYNASPVSTQPSGLLPAPVFHDENPRPLSVVTTSVINSRYPVDPR 282

Query: 217 PTLDAGESIWY 249
           P      S WY
Sbjct: 283 P----ANSYWY 289


>AY052367-1|AAL14775.1|  789|Drosophila melanogaster hephaestus
           protein.
          Length = 789

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +3

Query: 69  SGNGHIHQRANLQQRARVRAAYDARQ--QNGHEPQQQ-----HKLGSDRTVQQEQRTDAR 227
           S + H H   + Q  A   AAY A Q  Q  H+ QQQ     H++ +    QQ+Q+  A+
Sbjct: 38  STHPHPHPHQHPQHSAASAAAYQAMQVHQQQHQQQQQAAVFHHQVAAIAAQQQQQQQQAQ 97

Query: 228 RRRIYLVQQ 254
            +    +QQ
Sbjct: 98  VQHQQQMQQ 106


>AE014297-4833|AAO41627.1|  789|Drosophila melanogaster CG31000-PH,
           isoform H protein.
          Length = 789

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 7/69 (10%)
 Frame = +3

Query: 69  SGNGHIHQRANLQQRARVRAAYDARQ--QNGHEPQQQ-----HKLGSDRTVQQEQRTDAR 227
           S + H H   + Q  A   AAY A Q  Q  H+ QQQ     H++ +    QQ+Q+  A+
Sbjct: 38  STHPHPHPHQHPQHSAASAAAYQAMQVHQQQHQQQQQAAVFHHQVAAIAAQQQQQQQQAQ 97

Query: 228 RRRIYLVQQ 254
            +    +QQ
Sbjct: 98  VQHQQQMQQ 106


>AE014297-3192|AAF56027.3| 1346|Drosophila melanogaster CG31158-PA,
           isoform A protein.
          Length = 1346

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +3

Query: 87  HQRANLQ-QRARVRAAYDARQQNGHEP--QQQHKLGSDRTVQQEQRTDARRRRIY 242
           HQ A LQ Q+ +    +  +QQ  H+   QQQ +L      QQ+Q+   +++++Y
Sbjct: 705 HQLAALQRQQQQQEQQFQQQQQQLHQQHLQQQQQLQQQHQQQQQQQQQQQQQQLY 759


>AE014297-3191|AAO41590.1| 1480|Drosophila melanogaster CG31158-PB,
           isoform B protein.
          Length = 1480

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +3

Query: 87  HQRANLQ-QRARVRAAYDARQQNGHEP--QQQHKLGSDRTVQQEQRTDARRRRIY 242
           HQ A LQ Q+ +    +  +QQ  H+   QQQ +L      QQ+Q+   +++++Y
Sbjct: 705 HQLAALQRQQQQQEQQFQQQQQQLHQQHLQQQQQLQQQHQQQQQQQQQQQQQQLY 759


>AE014296-687|AAF47791.2|  937|Drosophila melanogaster CG32264-PA,
           isoform A protein.
          Length = 937

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 15/48 (31%), Positives = 23/48 (47%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARR 230
           H +  L         + A QQ  H+P QQ +    +TVQQ+Q+   +R
Sbjct: 9   HHQRQLLHHQHSHPPFQATQQ--HQPAQQQQQQQHQTVQQQQQQQQQR 54


>AE014296-506|AAF47681.2| 1473|Drosophila melanogaster CG32296-PA
           protein.
          Length = 1473

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 14/57 (24%), Positives = 31/57 (54%)
 Frame = +3

Query: 84  IHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           + Q+   + + +  AA  A QQ   + QQQ +    + +QQ+Q+   +++++ L+ Q
Sbjct: 817 VKQQLEAKIQKQKAAAAAAAQQQQQQQQQQQQQQQQQALQQQQQQQQQQQQVRLLTQ 873


>AE014296-123|AAN11448.1|  581|Drosophila melanogaster CG17129-PC,
           isoform C protein.
          Length = 581

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 20/71 (28%), Positives = 27/71 (38%)
 Frame = +1

Query: 37  TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           +PP P    SNPATA +  +       G +P     ++     S  T SV  + Y     
Sbjct: 397 SPPAPATTSSNPATAPYNASPVSTQPSGLLPAPVFHDENPRPLSVVTTSVINSRYPVDPR 456

Query: 217 PTLDAGESIWY 249
           P      S WY
Sbjct: 457 P----ANSYWY 463


>AE014296-122|AAN11447.1|  581|Drosophila melanogaster CG17129-PB,
           isoform B protein.
          Length = 581

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 20/71 (28%), Positives = 27/71 (38%)
 Frame = +1

Query: 37  TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           +PP P    SNPATA +  +       G +P     ++     S  T SV  + Y     
Sbjct: 397 SPPAPATTSSNPATAPYNASPVSTQPSGLLPAPVFHDENPRPLSVVTTSVINSRYPVDPR 456

Query: 217 PTLDAGESIWY 249
           P      S WY
Sbjct: 457 P----ANSYWY 463


>AE014296-121|AAF47402.2|  581|Drosophila melanogaster CG17129-PA,
           isoform A protein.
          Length = 581

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 20/71 (28%), Positives = 27/71 (38%)
 Frame = +1

Query: 37  TPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAPYNKSKE 216
           +PP P    SNPATA +  +       G +P     ++     S  T SV  + Y     
Sbjct: 397 SPPAPATTSSNPATAPYNASPVSTQPSGLLPAPVFHDENPRPLSVVTTSVINSRYPVDPR 456

Query: 217 PTLDAGESIWY 249
           P      S WY
Sbjct: 457 P----ANSYWY 463


>AE014134-1407|AAF52607.1| 2016|Drosophila melanogaster CG8552-PA
            protein.
          Length = 2016

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 7/80 (8%)
 Frame = +1

Query: 40   PPPPLRYPSNPATAIFTNAQTYNNAPGYVP---PTTRDNKMDTSRSNSTNSVAIAPYNKS 210
            PPPP    S  A++IF      ++AP +VP   P +  +    S+ +ST+S+   P   +
Sbjct: 951  PPPPTG--STTASSIFAAPPVASSAPLFVPVPGPPSVSSLFSPSQVDSTSSLFAPPPTSA 1008

Query: 211  K----EPTLDAGESIWYNNV 258
                  P  D   +++ NN+
Sbjct: 1009 NTTILTPAPDTTSTLFANNI 1028


>AE013599-2620|AAF57748.2| 1043|Drosophila melanogaster CG5109-PA
           protein.
          Length = 1043

 Score = 29.1 bits (62), Expect = 6.5
 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 2/66 (3%)
 Frame = +1

Query: 28  YYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVPPTTRDNKMDTSRSNSTNSVAIAP--Y 201
           YY T  P   +P++P+T   TN+    + P   P           ++N+   ++ AP  Y
Sbjct: 71  YYATTGPQTTHPTHPSTIQITNSFAQQSTP---PKQQAATSCSPFKANNIRIISTAPSVY 127

Query: 202 NKSKEP 219
           + +K P
Sbjct: 128 SLNKPP 133


>X00854-2|CAA25408.1|  413|Drosophila melanogaster ftz protein
           protein.
          Length = 413

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 11/36 (30%), Positives = 18/36 (50%)
 Frame = +1

Query: 22  NFYYNTPPPPLRYPSNPATAIFTNAQTYNNAPGYVP 129
           N Y+    PP  Y ++ + A + N   Y++  GY P
Sbjct: 20  NMYHPHSLPPTYYDNSGSNAYYQNTSNYHSYQGYYP 55


>DQ138938-1|ABA86544.1| 1374|Drosophila melanogaster CG8896 protein.
          Length = 1374

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +3

Query: 39   PSAAAEVSL*SGNGHIHQRANLQQRARV-RAAYDARQQNGHEPQQQHKLGSD 191
            P+ +A V L SG+G      + Q  A+   +A  A+QQ   + QQQ   GS+
Sbjct: 1318 PAPSAPVHLRSGSGLSQASTSTQSTAQASTSAAAAQQQQQQQQQQQQAAGSE 1369


>AY325814-1|AAP88969.1|  509|Drosophila melanogaster traffic jam
           protein.
          Length = 509

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = +1

Query: 43  PPPLRYPSNPATAIFTNAQTYNNAPGYVPPT 135
           PPP +Y   P  AI  N  +    PG VP T
Sbjct: 118 PPPEQYGPLPGQAILVNTSSGAGVPGGVPST 148


>AJ131022-1|CAB55429.1|  523|Drosophila melanogaster C2H2 zinc
           finger transcriptionfactor protein.
          Length = 523

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGH-EPQQQHKLGSDRTVQQEQR 215
           HQ+   QQ+ + +  +  +QQ  H + QQQH+    +  QQ+Q+
Sbjct: 432 HQQQQQQQQQQQQQQHQQQQQQQHQQQQQQHQQQQQQHHQQQQQ 475


>AE014298-1804|AAF48196.2| 3604|Drosophila melanogaster CG4013-PC,
           isoform C protein.
          Length = 3604

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 14/56 (25%), Positives = 29/56 (51%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           HQ+   QQ+   R     +  + H+ QQQ +    +  QQ+Q+   ++++ + +QQ
Sbjct: 196 HQQQQQQQQQDQRTNLHLQIHHHHQQQQQQQQQQQQQQQQQQQQQQQKQQQHHMQQ 251


>AE014298-1803|AAN09315.1| 3604|Drosophila melanogaster CG4013-PB,
           isoform B protein.
          Length = 3604

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 14/56 (25%), Positives = 29/56 (51%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           HQ+   QQ+   R     +  + H+ QQQ +    +  QQ+Q+   ++++ + +QQ
Sbjct: 196 HQQQQQQQQQDQRTNLHLQIHHHHQQQQQQQQQQQQQQQQQQQQQQQKQQQHHMQQ 251


>AE014298-1802|AAF48195.2| 3604|Drosophila melanogaster CG4013-PA,
           isoform A protein.
          Length = 3604

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 14/56 (25%), Positives = 29/56 (51%)
 Frame = +3

Query: 87  HQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           HQ+   QQ+   R     +  + H+ QQQ +    +  QQ+Q+   ++++ + +QQ
Sbjct: 196 HQQQQQQQQQDQRTNLHLQIHHHHQQQQQQQQQQQQQQQQQQQQQQQKQQQHHMQQ 251


>AE014296-2343|AAF49771.3| 2294|Drosophila melanogaster CG32133-PA
           protein.
          Length = 2294

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 14/57 (24%), Positives = 29/57 (50%)
 Frame = +3

Query: 84  IHQRANLQQRARVRAAYDARQQNGHEPQQQHKLGSDRTVQQEQRTDARRRRIYLVQQ 254
           I Q+  LQ + +++     +QQ   + QQQ +    +  QQ+Q+   + ++  + QQ
Sbjct: 209 IQQQQQLQHQHQMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQHQQQIIQQQ 265


>AE014134-3104|AAF53804.2|  509|Drosophila melanogaster CG10034-PA
           protein.
          Length = 509

 Score = 28.7 bits (61), Expect = 8.6
 Identities = 13/31 (41%), Positives = 15/31 (48%)
 Frame = +1

Query: 43  PPPLRYPSNPATAIFTNAQTYNNAPGYVPPT 135
           PPP +Y   P  AI  N  +    PG VP T
Sbjct: 118 PPPEQYGPLPGQAILVNTSSGAGVPGGVPST 148


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 34,428,873
Number of Sequences: 53049
Number of extensions: 823394
Number of successful extensions: 5577
Number of sequences better than 10.0: 77
Number of HSP's better than 10.0 without gapping: 3647
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5082
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3293648160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2022 -